SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221110161|ref|XP_002165837.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221110161|ref|XP_002165837.1|
Domain Number 1 Region: 411-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000291
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221110161|ref|XP_002165837.1|
Sequence length 617
Comment PREDICTED: uncharacterized protein LOC100205745 [Hydra magnipapillata]
Sequence
MYWFVFLLFAFKSKCLAAPYCSAEWCNPGHEPYPNIVSIMTGYNILQGNPFTSSHTSDPG
FSTGYIFVPTYKTPSGSYALHGGVTVRQTVQCSLSSSSDTITTLNDYAKKIGSKSSQGTT
FTSNLEFEVSAELKGVGVKTTIPPLVDAAFSSSNEYRNNELFFSQKRGVLTLRDATCATY
TVRISPFDPPPFSDGFVNSLIRLNNTDESKREAVVNDFIREFGTHFLQQTTMGARTAITR
RYSADEFKLSTDDQIQKCNEDRLKLTIAGVGVGRTSQSCNDIANSASSSSVDGFERESVT
SYGSKPATDLVSWSQQKFESPLPIKMELSSLLNLFTATHMKNHPTINYKGILKWLGPLMY
DYCEKNKVELGIKSCNPQTKNSCGWNDNCIPRQQVCNNNPNNIGYTCCTPKCSLLPCKNG
GTCQDITDSSCTFRCSCRNGWQGATCEEKYVVFDIIKAEIEQQMILHSGKSNDDFRGILH
QYLSQLYPKYYFTVNAYNEVSGFDGHSVIGSYVHFFRQHRRNLVVGWARHNSVFPPTDKF
NEIAGAVLRSVTNYRVDARESMDKAYAVAKSYGYPIVFVHVVRFGNGLRSHYNGYTSFQN
FKVGNHESSVVIMFGNN
Download sequence
Identical sequences XP_012563000.1.79663 gi|221110161|ref|XP_002165837.1| 6085.XP_002165837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]