SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221119793|ref|XP_002166571.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221119793|ref|XP_002166571.1|
Domain Number 1 Region: 112-457
Classification Level Classification E-value
Superfamily Subtilisin-like 1.22e-86
Family Subtilases 0.00000000283
Further Details:      
 
Domain Number 2 Region: 460-594
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-28
Family Proprotein convertase P-domain 0.0004
Further Details:      
 
Domain Number 3 Region: 29-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 5.1e-18
Family Prohormone convertase 1 pro-domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|221119793|ref|XP_002166571.1|
Domain Number - Region: 592-662
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.011
Family Growth factor receptor domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221119793|ref|XP_002166571.1|
Sequence length 763
Comment PREDICTED: furin-like [Hydra magnipapillata]
Sequence
MNSYLATFFTLQFLLCIWIKQVLTSDKIYTNTWAVNILGGEQAARELADLHNFDYRGPVG
SLPDLYIFSHKNIKARSKRSADEHQSLLTTHPNIIWAEQQIAKSRRRRGYEVISDPLFDK
QWYLKNKGQTRERCKSQYAGDNFEQLDINVVKAWNLNVTGAGVVVSILDDGLEHSHPDLS
RNYDSLASYDFNSGDSDPAPRYSQDNINKHGTRCAGEVAAEINNNVCGAGVAFNAKVGGI
RMLDGDVTDAVEAGSLSYKPEHIDIYSSSWGPDDDGTTVDGPGQLALNAFKAGIEKGRGG
LGSIFVWATGNGGRFQDYCSCDGYINSPYTISIGAVDNCGMKPWYSEACSGTLAVTYSSG
DASGQFDKQIATTDLHGTCTQSHTGTSAAAPLAAGIFALVLEANKKLTWRDMQHLIVKTS
KMVSPKDDEWQKNAAGYYVNPKFGFGALDTGGLVEMASSKDWKTAGAQHVCHTTKNDVNE
FSAASTDSYIEASGCENDKGSCVTKLEHVHVIINLKKNRQRGQLSISLTSPHGTVSKILQ
KRPRDTSEEGFKNWAFLTVFHWGESPKGKWKLSINDQTKEGFTLVSWYMTFYGTCDNKIS
DPFKIQINESEICDKICKKGCPEVFFDSCELCEQYCDCTIGRCVKQCANDLITDNQLHLC
KRSLEYQEEHTLNVLVARELKEQPVIGISMTAKFAIIFLALLAISAMVSGIAFFIANMPQ
SKTFAQGYRSVSRYPCTDTVEEGLIVDEDKSSLNSLETKIVKS
Download sequence
Identical sequences gi|221119793|ref|XP_002166571.1| XP_002166571.1.79663 6085.XP_002166571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]