SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221120412|ref|XP_002168146.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|221120412|ref|XP_002168146.1|
Domain Number - Region: 258-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00787
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 328-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221120412|ref|XP_002168146.1|
Sequence length 467
Comment PREDICTED: uncharacterized protein LOC100208917 [Hydra magnipapillata]
Sequence
MGVSIMGVKNIVLDLAISFLLFGACSAQIFQYFIVNNKDQTAKVIDTVKLPTCTHLDQKD
NVTLRGGIKSGKFTKHGVVKDMNTCIDACCQDELCNVAFMPGTTCYTVNCYSETLCDAVP
ATPSHLAQGSVQISHIIRGGGNGDDVDEFRKTNGVNRNSLPNGDQCVFSRVAYNQTISGG
KQAGEIIDLGKFVDIYDCAQKCCQHENCEVAQVRDHKCFAVDCFTKELCVSEPVIYATEP
RAIVYMNKRNRKRQINKAHCEPSCVNGICTNNNTCTCDVGYKGLRCNEIEVIGSCDPECG
IYGSCLSNDTCLCEDGWEGYKCDKKLVCAKECVHGTCINKQKNTCICEVGWSGFLCNETT
SDKLVVASSGEEVLFTDSDTEPELDIKIHESPSVHETESVSALAVAICCGIAAAVLGTAS
VVFIARQILGRRSAVNYEYLNKPPNENVSNNYKKNEQKQKTHSKRYP
Download sequence
Identical sequences XP_002168146.1.79663 6085.XP_002168146 gi|221120412|ref|XP_002168146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]