SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221125637|ref|XP_002161662.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221125637|ref|XP_002161662.1|
Domain Number 1 Region: 21-239
Classification Level Classification E-value
Superfamily L domain-like 3.23e-38
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 312-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000872
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 396-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 356-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221125637|ref|XP_002161662.1|
Sequence length 485
Comment PREDICTED: slit homolog 2 protein [Hydra magnipapillata]
Sequence
MRLIQLTILQFVYIAFGDSCPSKCLCTNNGEISCTKQNLTSKDIEMMLFPINATMLNLTE
NLLTYLPTNIFNNFTKLKTIDLRRNLLDYLPSNLSLEIPSLNVIYLNNNKLREIKESSFD
GYDKIITLDLSGNLLENIPPSVFKKCADLLHLNLRANQIDKINDQSFATLEKLRTLSLSE
NKISFIPPGSFNSLKSIEVIKLDANKLEMIAEGLFSTHLIELHLASNKIVQVLPKAFHNQ
DFKILDLSDNYITTLSMDSFVDVYYESLVLDGNPIICDCRLNLLVDQYHRITGSCQLPSA
LKGLSLSNVLSHNFLNCTICSINPCQNEGKCIIQSEGDKYSCVCEPIYTGKNCETKKKLC
ELNPCLNNATCSDVNSTKGYICNCTFNYKGQNCKDLKVCLSNPCHNNGICIENVSHEKHR
CKCQRGFEGTFCQKRAKKFPPGWIALIIVSVVVLVIIGSVLYFCKFRRQKTVISEESPLN
VKPVM
Download sequence
Identical sequences T2MBW6
gi|221125637|ref|XP_002161662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]