SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221130683|ref|XP_002158419.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221130683|ref|XP_002158419.1|
Domain Number 1 Region: 420-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221130683|ref|XP_002158419.1|
Sequence length 621
Comment PREDICTED: uncharacterized protein LOC100215110 [Hydra magnipapillata]
Sequence
MFPLMLSLMFMLVERPSSTIAAPYCKAEWCNPNHEPYPNIGSIMTGYNILQGNPFTSSAL
HDPGFSTGYIFVPTYKTSSGAYALHGGVTVRQGVQCSLSSSSDIITTVEDYAKKIGAKSS
QGSSFTSNLQFEVSAELKGVGVKTTIPPLIESAFSSSKEYKNNEIFFIQKRGVLTVHDAT
CATYTVRISPFDPPPFADGFVNGLIKLNNSIESKRELVANDFIREFGTHYLLQTTMGART
AVSRRYSQDEFKKSTDDQIQKCNEDRLKLTIAGIGNGRTSQSCKDIDNAASSNTVDGFER
ESVTSYGSKPAADLVSWSQQNFESPSPIKMELSSLLNLFTADHMNKHPSINYKAILKWFG
PLYYNYCEKNKVELGIKSCDPQTQNSCGWNDNCIPRQQVCNNNPNKIGFTCCTPKCQLLP
CKNGGTCKDITDITCTYQCSCPRGWQGTTCEEKVVFDDILRAEVERQMMLNSAKTNDEFR
DILHRYLTGLYSNYFFTVNAYDEVIGSEAHSVIGTYVQFIKTHKRNLVVGWAKKNSVFPP
TAKLNEISAAVHRSVNGFNKEAKASAEKAWGVANSFKFPLVMTHVVRFGCGLRSKFSGVT
SFQNFTVGGHDSSVVVMFGSP
Download sequence
Identical sequences gi|221130683|ref|XP_002158419.1| XP_002158419.1.79663 6085.XP_002158419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]