SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662217|ref|XP_002157743.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662217|ref|XP_002157743.2|
Domain Number 1 Region: 1104-1228
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.84e-22
Family TSP type-3 repeat 0.0000429
Further Details:      
 
Domain Number 2 Region: 1367-1521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-19
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 
Domain Number 3 Region: 1234-1364
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-19
Family Thrombospondin C-terminal domain 0.00044
Further Details:      
 
Domain Number 4 Region: 1032-1108
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000523
Family TSP type-3 repeat 0.00044
Further Details:      
 
Domain Number 5 Region: 819-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000258
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 957-1030
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000366
Family TSP type-3 repeat 0.001
Further Details:      
 
Domain Number 7 Region: 871-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  gi|449662217|ref|XP_002157743.2|
Domain Number - Region: 619-633,660-775
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000212
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number - Region: 481-572
Classification Level Classification E-value
Superfamily Cadherin-like 0.00585
Family Cadherin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449662217|ref|XP_002157743.2|
Sequence length 1586
Comment PREDICTED: uncharacterized protein LOC100210231 [Hydra magnipapillata]
Sequence
MFIGKASLCSKGEKYECDRLKIFKDKCQVDGCDVSASNALETRTCTLDGYTTVVGTKEID
VIYYDFSKTEPAFSAPSYEKNTCCPTYVNSPFESWLKNRDSKESIAIQNWFTSAYEGSRK
IFGKITLLSEITSIDKETGKNFYLFWDDNYWPVNDRGFSAQGQKDCYGKELVNKGYVHQA
KGHKNYLKYQLLTVKHRAQNIMSWANLIRHCIGSMYLIDKMNKNMYKDIVKDVMLPHAKD
KMPQGRIIGLLYSEGEQFQFGGGEDLWVYINKVLVLSVLADNADISKNPYDVKCKTFELK
NLTSGGYIVPSEGKVDKLSKTCTNLTVLKSESVYLNLQIGVIYSFEVFHVERFSCKSQFF
FYYSGATFKAKSDVIDYLAFPKEDDQVNSIIADVLVSDDYDSSGYPYQISIVSGNEEGKF
IFKKNNTQANIDAQSKPPPRIYPNVTLHGESIIICPNVTQVNGTSNSSSTTPLIFVVDQS
DNCPIIFPKYELVEYNPIPPLNPFVSLFMVEASDLDSGENGRITFVVSEIREKIPTIEAK
EFLVENNTVWVNTTIKWRISVDIFAVDNGDPRRGDFFRIFLSYDPSCDKTGKVTVNETTG
YVRFIAPNMTIYNKEKKRYGIEKCYECTAGYFCPGDGSEKPCVQNEETKHFFSYGYASEC
SLCPKGHLCHNGIITKCPENTYVECNTTWCPTECLECPPGFYCFEGVKEICKPGTFSNGK
GFCQLCPPGQFTNISGADQCQCCGRGKESTSMKQGCQGCQPHEYSTGNCSICSSCRLLGS
CACESNPCFEGVSCHNFVNEEGFPDFYCGLCPKGFDKDDKNGCIDINECIINPCSNYTKC
VNMVPGYRCTGCPPGYNGTTSAGVGLEHAENNKQRCNDIDECALGTNICDENSICTNTLG
SYFCGKCNPGFVGNGYIGCKPGNYCASNKTNNCNLVNGTCIPLGSKLFYCKCNDGFAGDG
IVCDVDHDYDGVTTYGAACTSFACKEDNCEYTPNGGQEDIDSDTLGDVCDDDDDNDNIKD
INDNCQFYNNIRNQSDSDGDGIGDVCDNCPSIKNEDQTDTDNDKIGDACDDDIDGDGIIN
SMDNCKNINSINQSDSDKDGVGDLCDNCYKHRNPDQIDSDLNGFGDQCDVPYLDFDGDGI
INDYDNCIYLPNADQGDTDQDGIGDFCDEDKDGDSVLDQLDNCIYVKNELQEHSNHYNMD
FKPIGDACFKDFDGDKVLDQFDDCPNAVNIQKTSFLTYDLVDLAPKDSSEPRPKWRIRNK
VNKIGTSPLTDAFVNALWYSGDSDGVTVLWQDPKMVGWEHRQSYIFKIELRPSLGKIRLL
IKQGSLVLADSGYIEESSINGGKLGVYTHGQWNTVWSNLQVRCLERMNKALFFNQSCVVL
PSFSKLQITSSFTIGIWLKITNNNSTQPIICSQVFCLYLQNRFLKFSLSLVITEANVPLL
DDKWQYIIIQYDSFNQNIQIFVDGALYALRTEVPIQKFEADEVKEAPIYLGCYLNEYFVG
TMDEILIWNIFVERDEFIKITTKWPEHQRRIAAHYTIDQTPSVTLFDSSEYENNAIVNNT
LWVESTIDYARYFLSQKPKTFLRDEL
Download sequence
Identical sequences gi|449662217|ref|XP_002157743.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]