SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662569|ref|XP_004205574.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662569|ref|XP_004205574.1|
Domain Number 1 Region: 44-154
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000000000157
Family Netrin-like domain (NTR/C345C module) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449662569|ref|XP_004205574.1|
Sequence length 188
Comment PREDICTED: uncharacterized protein LOC101240594 [Hydra magnipapillata]
Sequence
MDFFIDEKRTELYKRINLSMNRNCRRDIVSTLPSLTSTTSTYAGNICEKQCDMNNFKRMY
CLSDFVARLKITEVNLNNSDGHYVAHVTKQKIFRHPTFLKISKRNQRIESFSLSLTCECK
PLEIGKRYLLFGREDVNQNLLFVNKYSLAFELSENIGLYKEFLQSYKTIKCPPYLMRWFN
NRNSKWFA
Download sequence
Identical sequences gi|449662569|ref|XP_004205574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]