SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662694|ref|XP_004205596.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662694|ref|XP_004205596.1|
Domain Number 1 Region: 11-83
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|449662694|ref|XP_004205596.1|
Domain Number - Region: 140-175
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0647
Family YdcK-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449662694|ref|XP_004205596.1|
Sequence length 427
Comment PREDICTED: uncharacterized protein LOC101240553 [Hydra magnipapillata]
Sequence
MTSQQCVDATKKVHDPDFQSKVTCILDTENPFFVMNVMCIYVKNGALIDYEENKNFTLKI
VCTDDGQPPLSVSSNITIEVKDVNEAPTKICLTNTLISPDMHSYGSELSQILIEDPDIIE
TKEICLSKVQAFKLFINIYNCSIYYDRTLPYDLIVGNNLTIQSNSVIEKFSVDKVFKFVI
KCWENLVPSNSIQSSDVFTIQGIPCPSPFVQLGAGCQCPKGLTGLNCDRNESLCLNGQCL
LNEICSIFIKAKTSCVSKEFVLPVLLNTDFKTYYSGNFRFEMEMFVTETLHGNMTSYPVL
SRKRRNVDVFLVESSSEQPIGSSYMFVKFILMDQEYNLVNNVQPCKILSTNQKLHCLNEA
DCKIMKQYGFPCTPSISAEMLLTNSQSNSTKTKSWVIWLVVVIVIVVVQGIVVFVCRARR
QKINSKV
Download sequence
Identical sequences gi|449662694|ref|XP_004205596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]