SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449662752|ref|XP_004205606.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662752|ref|XP_004205606.1|
Domain Number 1 Region: 690-845
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 2 Region: 903-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449662752|ref|XP_004205606.1|
Domain Number - Region: 983-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00035
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 1107-1150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00628
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 1154-1199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00791
Family Laminin-type module 0.036
Further Details:      
 
Domain Number - Region: 1197-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 952-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family Laminin-type module 0.059
Further Details:      
 
Domain Number - Region: 1020-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0991
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449662752|ref|XP_004205606.1|
Sequence length 1719
Comment PREDICTED: uncharacterized protein LOC101236159 [Hydra magnipapillata]
Sequence
MTKRILRNNEIPRNRCFIMYTRVIIFLILMKKLSAIFTGFHLGDFPPADFSKTVKLSSQS
NSFVEVKHFFGKIPFHVQVYAIANDGNNKGFKFDGTGACQSDVKDNNAYGGVIFAYDNTT
VRVWVPTRSSSSKVGSVIFVGGSWGGNSFFQDSVDAEVTIEAWKDGPAPSFEVITEVDAG
LEKNTNIIDHDLNQLPEIVSVRIFSGVNPENSYIFHATGVTQTSSNREYGGVIFAYNEKK
VVLWPPNKSKTGCTLLNKKWGNGKYYTEMYSKTCTVHIRLWINSFPPPIFQTTWKSIDVR
NLSTQFLEIKHNLKMYPSYVKLQYRSVNKPYSLVFEGIGSVQSSVNNLRHGGLVFAYDKV
SVRIWLPSSNNSHQSKQLLFAIFVGDGWGNSDENITEILAEFRIQIFLNRCLESEKVVDS
QGCTGQSLQTMLDCKFENDFCNFLTTSWKRSMGQNEMNDENKHLKIPLQGLKKDGFFVYS
TEDVWSMNDAESFNPNVWLTGYLNIGYILHHIKRFRFVHRKQKNTINDPVSVTDIVLKCI
KPDEFKMTAEACKEKEETLPSCFIDKPLSGSAWSVSIPLNDIKNELGPYVTSNGVYNDLI
AIYKVQVIKAGLYNLWIETFAMSNNTNSVIVKINEDVTVADTPFNKRTGMWLPINKVFHL
RAGSYMIMLLQKEKYFSFKSMMLNPKDIVVWSELGMQSRHIPDSNIHSTSSADSYLAYSR
LNGRASWMTIDTSIELIYLEIQLPDIALINKIATQGGTWLDTARPNFYCYIKRYKIKYSL
DGHNFAFYRNLTTKETVVVEGNNNLSNLIVEHIFDFVLVAKSIRVYPSNTTRDQFICLRT
ELYGYYKTNGTCPIIISKPRQEVCQGSGECENINSRCQIDPSNNQSVCLCNEGFHGNLCQ
FVGCSSNPCLNGGVCNENGKSIICICLPGFHGVYCQAVCPKGKYGVNCGSSCNCPENEYC
NPVNGSCLCEPGFHGNDCNENESMLCDHINGECFCKEGWMGNQCSLSCENGYFGRNCSQK
CNCRNGGTCNTINGVCTCTPGYYGPYCEHTCPSNKWGENCSEYCLPIKNSICDHITGQYT
CFPGLTGSFCDIECAEGKFGNNCMQLCDCDKNTEKCDKRTGECICKLGYKGERCEESCEN
YLPMSWGYQCRNLCNCKNAVSCDAVNGKCICIDGFSGTNCDEQCNEGYYGKNCSLRCNCE
KKNTEVCETVGGYCKCHPGYTGVSCNETCKEGYWGKNCYESCHCYNNAKCDHEDGFCYCA
PGYHGSYCEIPCSKGMYGVDCKQKCQCKNNGDCNNVDGHCSCTPGFAGKFCESKCAQGKY
GKNCSSNCRCVASNTQECDSVDGFCYCKNGFIGIKCEKECDNGFLGNKCNDVCPVCYYNN
NTACDKRYSNCSCPNLFTSKDCLEYCDWSHFGYMCKQECNCKINEICNNVNGQCYKSDLY
LVTIKLRAPSQLFLEISLQREIQRNFEKLMYYCFERLEKLLLNTSTLNSPSINISHISTC
SSVGGDQMFDSVNTENSSLYVMRIYSVFAMFIESEEITGLTFTLLKKTQPVNASFILDVI
SFIGINAFSAVLNFEYYVGEASLKKQEELWYTKTVYLASVILSVFTAILFFFGIIILYRR
KVQSSPFEKVRRESNDIELKSCLVNGKGHAYSFENPYYDVIAAMGLDDEIEEDYYNPLYM
LDIPLDSDNELDDMYYVGHKSERSPFLYDKDSGISNAVL
Download sequence
Identical sequences gi|449662752|ref|XP_004205606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]