SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449663868|ref|XP_004205824.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449663868|ref|XP_004205824.1|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000709
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 249-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000129
Family EGF-type module 0.064
Further Details:      
 
Weak hits

Sequence:  gi|449663868|ref|XP_004205824.1|
Domain Number - Region: 96-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449663868|ref|XP_004205824.1|
Sequence length 309
Comment PREDICTED: uncharacterized protein LOC101236066 [Hydra magnipapillata]
Sequence
MDTPTLSINGSLTIASGSSLIIKCLVVSSSPLQVSYLWYKDGYLLPNTSNESEELVLRYV
EQENSGHYSCSSKFVAFVKSSEDNLTLTVKQGFLPQCNNNWLLVYQNNNWECICKDGFYG
DNCEQKNQVVQAKVSIMSVCNQTVCYSGTSLRDQLSFNHFYIFLKQSFEEQMLSSFRAEL
QEDYVVQVKWINHNFEEWLNIDYLVYFTNSHKSVSQQQQLVQMVAVKYFYNRVHTKNVFS
FQIIAKLTRLKDFDYCYNSTTLCDTHAECLNGLGTHFCRCRSGYAGDGIKCDPILSCDFD
GQKKCKFLA
Download sequence
Identical sequences gi|449663868|ref|XP_004205824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]