SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449663986|ref|XP_002169416.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449663986|ref|XP_002169416.2|
Domain Number 1 Region: 231-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-34
Family Laminin G-like module 0.0048
Further Details:      
 
Domain Number 2 Region: 17-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-27
Family Laminin G-like module 0.0094
Further Details:      
 
Weak hits

Sequence:  gi|449663986|ref|XP_002169416.2|
Domain Number - Region: 209-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449663986|ref|XP_002169416.2|
Sequence length 559
Comment PREDICTED: neurexin-3-alpha-like [Hydra magnipapillata]
Sequence
MHSLTMLFVASLLFSVKGYTFIDLKTSYIKYKQWPAHQYGDLTFRFKTSSPYGLLLYSDN
SKSKVSTSQNFIKLQLTKGELEFTVQHGSEDYKSKKSVTIGKNLNDLTWHEVNITRNERE
TVIVLNKLIEKYLQNDGEYDELDLNSDIYLGGVSDQLATNIVDGAVLAMPRFVGCVEDFR
FKGKNNFGVWEEFDNQTLSSEGVKDGCLDACTTNTCENNGHCINYFTSAKCDCVGTGYFG
SNCSKERDSIQLDGHGYIDVELPDPLKSTIENTIIMRFKTRSDGLLLVAYSKSDHIMIEL
YHGIVRMSIDLGGGYHLLEIADILFNDGGWHLVSLKRNGREFALTVDKKYTLKKVTPGLF
SKFNIQDLFIGGHPVLDTIVNSKSKNNFSGCLQEVLFNEIDIVYKTLNTESSRFQMVGNI
KNGCDVVKSKVLSSRDSAGPMVSKSGSVDVPVQPYFTPIKPYEVNDHITAQYAPKFIHQK
SSKKLSKQIITWIIIGIIVGSIALIVAIAILVHGYKKRYSTIVLSKKDRNSNLLNNYKSS
QDTIVIYKANQGLLQPRLV
Download sequence
Identical sequences T2M365
gi|449663986|ref|XP_002169416.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]