SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449664024|ref|XP_004205857.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449664024|ref|XP_004205857.1|
Domain Number 1 Region: 124-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000066
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily L domain-like 0.00000595
Family Ngr ectodomain-like 0.021
Further Details:      
 
Weak hits

Sequence:  gi|449664024|ref|XP_004205857.1|
Domain Number - Region: 211-274
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0199
Family Hormone receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449664024|ref|XP_004205857.1|
Sequence length 468
Comment PREDICTED: probable G-protein coupled receptor 125-like [Hydra magnipapillata]
Sequence
MGADLRNNYILSISQRAFEKVSSNDLDLSGQRNYGGKRAELIAYNDFLTLSKIKKLSLDD
NQLLCDCNIKWIGNWLSKDGQLSEKTSCYYPEQLRGKSLKDLLNSSWNCGEHQQSFFVPN
FQLIPSKNQIGFENDEMQFTCFSTWIMKSYMMWIKNGKELFTDKLKRIEIRHHSNLTLAV
HSSVLLIHRLNLIDSGAIMCQLLVHGSGNVSSTINLSVISKNSPNCKMSVTKSDQGHIMW
PTAYFNTAIKAKCPYGGVSLAERSCGNGTWNNFSMENCFFGNPITKALQLFHMNVKAAES
TDGKTIVDIYTNFIWGSIGLIIMKHKELHSLEEKVNNYSAIFRFQQLLETFLYEESSKKS
WSFSIENHPILAALSYKVNTEKFVQCYVISSNIPKIKGKSNKIVCAIEKNSSIEKKHSCP
DIDELNVDDCEDNCEKLGFDFDFNLDCQIPLLLLFKVDRCGRLNCTGS
Download sequence
Identical sequences gi|449664024|ref|XP_004205857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]