SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449664364|ref|XP_002160509.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449664364|ref|XP_002160509.2|
Domain Number 1 Region: 1281-1436
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.08e-42
Family APC10-like 0.00000282
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000432
Family Formin homology 2 domain (FH2 domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449664364|ref|XP_002160509.2|
Sequence length 1462
Comment PREDICTED: uncharacterized protein LOC100201345 [Hydra magnipapillata]
Sequence
MLNQKTEEIKCGIKEVKNSISNNNYKDQFVCALTHFSDKAYNTFYELLIGYSRMQFEFQE
FVDFFKDDFTKTATEDFFGSFAIFLQHIVTTKDFLLKKEGESEGDTRTLNKLHFINCNTV
TRLDNNIEKMSTNLINEEENVEFACLKEIKTNRMSVVKRAAKTDVETVSNYKNEVCDNYE
MVYTKGKSVPKKPQRLSDKNSEKLNNFPKDNYCIMREENEELEYGEHSIDKIAAKLSAVP
INGSFSRGKMKQIPFMTANAWPLAVDICPDMNNLHYEADIIKTETIENQIASHKDNEVKN
CSNVKYLCREPINEVINDSVQLGSSDCSSTDRLPMKKTNTFSPLPWVSPLNSPVEQRKLH
RSGEEMLNSIGISKSSNIKRTTNDITKSLMNNQIKSEPQINAKNAQLQLQDAELYGINNT
LSFHTYKNLEDDYDNGRRDKYEYDTFTENIENPLNGNIEIPLNEGLKLNKIKLENNEKPF
HAKNENQSSNNSSDINLTDLNLKKNIDSSEKLYRNPLSSSEHEEALNTSRQHQTNPVFID
LMKAKLNADRQRPVFKRKITDHEEPLYASVIKESLQEYESQRSSNIITKNENLSVQKIST
PVDFMSILQKKFVEANPDIHNNIHDNPSQLAIAYEPIYADVLEKTLIDYEKEKNEHERVR
KLGLAFQSKFINDDTIDRSSPNFFGILEDNMIENKLLFADDSDSFNQKDEPICALVIKAA
LKWYRKTVIHQKSSKVKVGQASSLSRSPSDASSTSEEVRIINTSIMDSSPQVYLSDSELA
LPKIPSPDYTCSKFHVSDVFYEKDVEKKVESYLETSGISNENFFLLKEKTNNMESHPYHI
DRPFWNETENNVSLKNNNTKRSSLKKKPSDIKPNSVSFFKNVEVFNENDELNEKEVVRKE
EPLKGSPQIDKKNEKRKKTPYSELPVVQPLISANLIENKPIILNIPDNAGVMQSVELSEE
DLQDIAKEHNISLEELKGGSLIYNLLFDLITTTYPNGKVTTKLVPQGQGEKFVNDILLKE
KLREPKFPVLPSANTPPPLVNRLTKPKNISRSPIIPANSMDFDIRHGKDSLIRTIIPSPD
YLDEVSEDTEKIIDLDLLKETEKKLKNHTYNEIDLKEVNEPFVKSINEPVSKSAGKKLFN
NATPLSIEKNLIKLSIEYENPEYSSDSIQNINLKNNQPIAYDNKDLIFQSADQSVSRDVN
QSIDQVKYDKVFKTIGRNDHNPDYNPDYEEDYCNEDPPQLPDRSKKPVKKSCLVVTPVSL
PPPSPMPHSPKFLMADDSKINTIPISSIFSDDLQDQVREIGENAVWSLSSCKPGFGVSEL
RDNKLTTYFQSDGPQPHLINIQFPWKQAVRFVSIYTDYKSDESYTPNRISIRVGNDKHDL
KQKELLELDEPCGWINVELDNNGNTLKTFMIQIAVLGNHQNGRDTHLRQIKVFAPKVNST
SYKIPSIEQLNDPVLTELSCIR
Download sequence
Identical sequences gi|449664364|ref|XP_002160509.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]