SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449664450|ref|XP_002165261.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449664450|ref|XP_002165261.2|
Domain Number 1 Region: 22-356
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.51e-100
Family Glycosyl hydrolases family 35 catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 444-570
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000247
Family Beta-galactosidase LacA, domains 4 and 5 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449664450|ref|XP_002165261.2|
Sequence length 589
Comment PREDICTED: beta-galactosidase-like [Hydra magnipapillata]
Sequence
MIFNVFICLLIVFAKISSSERTFKIDYENNKFLKDGTEFRYISGSIHYMRVPEDYWEDRL
SKIRKAGLNAIQTYIPWNFHEPTEGNFQFGGQQNVFKFLKLAQKYDLLVILRPGPYICAE
WEFGGFPYWLLKKVGNKTMQLRTSDNLYLQKVENYMSVLLSGLRPYLYENGGPIITVQVE
NEYGSYGCDHEYMYKLESIFRKYLGENVILFTTDGAGDSYLKCGTIKPLFATVDFGPTAE
PKLYFDIQRKYQPLGPLVNSEFYTGWLDHWGGQHAHTSLEDVTDTLDKMLSLNASVNMYM
FEGGTNFGFMNGANQDSNSLQPQPTSYDYDAPLSEAGDPTEKYFAIQHVVSKYLPIPPGP
QPKPTEKTAYGKLYAYKVVSIFDALDEMSRERRYESTSLSFEDLDVAYGYVLYNALVLQG
VLDRNSNNSILLNCSVNQIELSIMVENQGRVNYGPFMTDTNKGILGDVLWNGERIDVEVK
HVLDNDVFKNVRNVAVISSQVASPAFYFFNLSILIEPTDTFLKLDIWRKGVSVVNAFNVG
RYWWIGPQKTLYIPRHVLQKDNIIVLFETETIFPITDAYIEFVSSPIIG
Download sequence
Identical sequences gi|449664450|ref|XP_002165261.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]