SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665012|ref|XP_004206045.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665012|ref|XP_004206045.1|
Domain Number 1 Region: 28-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000509
Family EGF-type module 0.045
Further Details:      
 
Weak hits

Sequence:  gi|449665012|ref|XP_004206045.1|
Domain Number - Region: 71-129
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000392
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449665012|ref|XP_004206045.1|
Sequence length 398
Comment PREDICTED: uncharacterized protein LOC101239955 [Hydra magnipapillata]
Sequence
MSKNIPEHQNQVLAREIEVTENNCSSVNINECLNATSCSENAECINFNGGFDCQCKQDYS
GKNETNPSAKICYENNVWSSWEQVGHCSELCQTDKKRGKLLFTRLCKMSSPVICQGNTTK
EEFCNSDYCDNKIKVLKSVQCESWENMEDSIDLPFKEENQTWIYEIRKWLGYYIFASECK
SLRIIDSYMQVKIENLQMEILHLKEIRLSLRKLIDCNTYLQKIDGLIHILNIIRCLCSTD
TKTLHGKQRQCRRHGIKCMTPCRQCQYLECTNATKNDDIIINDRENESESCEDGDGKIYE
KHLPFDLISKYISRMWQEHLDKGGIVGAMLMDLSKAYDSIPHDLVLAKLKDSEIYNYADD
NTLSVCDNNLDSIIARFQIEISNAISWFTLNKMVANPD
Download sequence
Identical sequences gi|449665012|ref|XP_004206045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]