SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665047|ref|XP_002154412.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665047|ref|XP_002154412.2|
Domain Number 1 Region: 58-202
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.52e-32
Family Astacin 0.00059
Further Details:      
 
Domain Number 2 Region: 701-816
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-25
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 3 Region: 336-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-19
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 205-336
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-17
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 5 Region: 497-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000343
Family EGF-type module 0.021
Further Details:      
 
Domain Number 6 Region: 582-693
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000222
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number 7 Region: 533-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000026
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 8 Region: 453-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449665047|ref|XP_002154412.2|
Sequence length 935
Comment PREDICTED: tolloid-like protein 1-like [Hydra magnipapillata]
Sequence
MCHAVNNGECPINLANKIPGPVVHSRWLTTANRVLRLYVSMEDPTENLVTLATFVVKVYA
PTCCCSYVGRRGGKQFLSLGTGCIRFGIITHELGHVIGFWHEQNRPDRSIYIDVIYENMD
SSKSFNFDPRNLNEVKTFDQVYDFHSIMHYGNNFFTKNGGKTILSKAPENAETNEIGMSY
FKYKGPVLSPQDILETNLLYRCTKLTECGGTIFATSGSFASYPNRYQQEMNKDCVWIITT
AIKFNSRSSLTVIFNDFSVGKPSHDQTGNCEDDYLEVREGKGFLSPFIVRYCGQRKPAPI
TTLAGSLYIRLHISGKNLKSYSENIGFNVSFKTDTCSQLIKQVPAIIHSPQFPFGYQLNT
DCVWNVEAQPGMQTKIEFGFFSLRELDNEEGCLDYVEIHKDLGTAESFVGRFCGSNNPGK
LVINSERVKIHFHASNVDHQGWFMGFEAEIDQYDIDECQLGLHECTQACINYPGGYFCGC
NQGYDTIYHRSSRKAQCVDKDECSINNGGCSHKCINTDGSFVCGCPKGFTISFNKSQCQD
INECVNKPCNQICKNNIGSYECSCYEGYILQSNNKTCSSLSGCLGSFTSSVGRITSPQVP
STYKLPIVCVWQVQGAPHLQLKFDIVLVSKENNDCGSYVTFFKNEMERRQKTYLKKICIQ
SDITDAFVMSTSSAIIEYVGQFPFQTSFMVEYHSVVQNERECLYTYNASSGEILSPGFPY
QYSDEQDCLWNIHSLHQTTFKVIFLQFSLESHETCEFDYLEVEQIYYEMQRVKKIGRFCG
ERIPDTLFINGHASFVRIRFHSDSTNTGKGFKMVFNETDHVRSGYSNDGNTARKAFSNED
LFADITEINKELIVKLHIILICISSGFQIDTSLFSEEAQEARNKELRKYREHHSRKNSRT
KTKEDVMNRLLCTSDPVISSYRKTVSSNIDLVRNF
Download sequence
Identical sequences gi|449665047|ref|XP_002154412.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]