SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665331|ref|XP_002157821.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665331|ref|XP_002157821.2|
Domain Number 1 Region: 643-826
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.04e-21
Family Laminin G-like module 0.0083
Further Details:      
 
Domain Number 2 Region: 23-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-19
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 234-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000652
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 4 Region: 833-1041
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000198
Family Laminin G-like module 0.091
Further Details:      
 
Weak hits

Sequence:  gi|449665331|ref|XP_002157821.2|
Domain Number - Region: 397-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 428-474
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0544
Family Fibrinogen C-terminal domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449665331|ref|XP_002157821.2|
Sequence length 1198
Comment PREDICTED: contactin-associated protein-like 5-like [Hydra magnipapillata]
Sequence
MHSSFIIFISFFIVSSVAEIDVDTNSFLIFRQPPFETQKNHIKFRFKTIDASGLIFLAQG
ATKKNFLSLELFRGKIRVAGNYGDGPENTLRPISGFYEMFLGKDLADNQWHTVEFIRNIR
ENIIFIDRGQGKMEKSIFMKSPPTYNQLSVSSVAFGGYYTFLDMSTEMSHARKGLKACFS
EASFSQYWPEIDSKKINFLDTNPSIETKGVINRICQDPPYSPIFFPSAATHIGFIENYTI
NSMKVELKFRTVINEQILVNYTTSGSGHVIELKIDRKGRVAIAVEFSSAKQIIVTAKEDY
HDGQWHQASFEIDNKEATDKSYILKLSVDGKTRLSSLSQSFYFNGYLNVGFGFTGCMRDI
KINDDDVKKVRRDWNDPKMFFTYDDTGVVYDSCSLKDYCNPNPCQHGSKCNQTADNLVCD
CHNTLYEGSTCNRPRFNYTCAGVRKSGERRSDVYYIDFDGMGPMEPVPALCDLGKTVETT
VTQINNTNYNDKDVTTPSGINNFDIDYAANIIQMRELILNSAYCEQYVKYTCKGTPLFRS
PEGPPAASWMGGDDILHYYWGGAKGNRGYCGCGMDGSCYNIGKYCNCDSLDAYKDLFDEG
NLTVKSHLPVRQVKFEQVLQGNSIHALLRVGHLRCAGFGSREIVATFRKPYSFLSVDHPD
QPYDNIFSGGISFEFKTSVAYNYMTLVHAHGPFSGDYMKVMIWSRTMVRVNMNFGFGDIQ
QDVDIEKIGRYIDDNEWHEFDLVFNLKELNITLDGVLMIQGLPLQEDPVQFNVDDKAVYV
GGSYHDEYGFVGCIRSLYVNGRIHDIRSIAQGQEDYGVYPGCGSACMLLNQPCNYGQCID
HYDSFKCNCSVSPYGGDFCQNESYPKSFTSGQYISYDLKKANITDPIATAVFVVGFKTLE
ENSALATLEGYNDRHFTLALTNGYLTLFYSLKKKLRNSVNVLTDFETEMLQISSRKFNNG
EHNLARVIISTDEIFLTVPNYDLVVGANMTERFKDEMNKNLGTEIDTFGMAATFSVGRII
NNGINTRSFTLASFFTGCMSGAKLVLTPLPNITHRFPKSVEIDLFKLLQVKTNDPDANPY
GTFPSETANCGPSLSIPGDLPTVGPARQYNTDSPGLDNSIKLLPVGIWSRVVIVAISFIF
AVIFIGVFFYVCSYTLRMNSMYNKAKNEKSLTTSEKSSRFPTNQENILVKSNFESDFL
Download sequence
Identical sequences T2M8X1
XP_002157821.2.79663 gi|449665331|ref|XP_002157821.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]