SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665333|ref|XP_002164252.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665333|ref|XP_002164252.2|
Domain Number 1 Region: 645-829
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-21
Family Laminin G-like module 0.0086
Further Details:      
 
Domain Number 2 Region: 20-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.81e-19
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 3 Region: 227-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000699
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 4 Region: 842-1051
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000257
Family Laminin G-like module 0.03
Further Details:      
 
Weak hits

Sequence:  gi|449665333|ref|XP_002164252.2|
Domain Number - Region: 401-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000277
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 432-477
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0184
Family Fibrinogen C-terminal domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449665333|ref|XP_002164252.2|
Sequence length 1215
Comment PREDICTED: contactin-associated protein-like 2-like [Hydra magnipapillata]
Sequence
MMSLKVLLMVTIVYPSIAELDFPTNGFRILRMNQVTTQNNYIKLRFKTTEATGLIFFAQG
ASKTEFLSMELFRGKIRVAANYGNGPVNQLRPIDGFYEMYLGKDLADNQWHTVEFIRKVR
DNTLYIDRGERMEKSAFTMSPPTYEELTVSMVTFTGYYSFHMNEISKQKSLSRKGFRACF
SEAIFSQYLPGKNGMMYDFLTINSPNIQSFPTNNVAQPCTNPAYAPLFFPSAAVHISLVQ
NYSIQSMKMEMKFRTVINEQILANYTTIQTADKIKLFIDRKGRVGVGVEFKQNMQIIQTA
TENYHDGEWHNASFEIDNIATTDGSFVLKFTVDGRTRLSTLNQAFYFNGYINIGFGFTGC
MRDIKINDDDIKSVRRDLKDPKQFFTYEDTGVIYNSCSLKDYCNPNPCQHGASCNQTEDN
IKCDCHNTLYEGSTCHRPRFNYTCAGVRKSGEKRSDVYYIDFDGMGPMQPVLALCDLGKT
VESSVTQINNTNYDDKDVTTPTGVNFFDIDYAANIIQMRELILNSAFCEQYVKYTCLGTP
IFRSPEGPPSVKWMGGDDILHYYWGGGKNNRGYCACGLDQTCFNVGKYCNCDDLNAYQNL
FDEGNFTTKEHLPVRQVQFDQVLKGSVTGKLRVGHLRCAGYGAREVGATFRKPYSYLSVY
FPDQPFDNIYAGGVSFEFKTSVAYNYLVLVHAWGPFSGDYLKVMIWSRTLVRVLLNFGFG
EIKQDVDIEKIGRYLDDNEWHEFDVMFNMKELNVTLDGILMIQGLPLQDDPVQFNVDGKP
LYVGGSFHDEFGFVGCIRSLYVNGRVSNIRQIAEGQEDFGVYPGCGSACVLLNRPCNYGY
CVDHYDSFSCNCSVSPFDGKYCQNETYPRSFTSSDQYYSYDFSKGNNTIVDRIAHGIFVV
GFKTIEDNVALAQLQGMNDRHISLALTNGYLTLFYSLKIKVRNSLGMVTDTETQVLRITD
RKLSNNEHNVARVEFSNEEIYLSVPTYGLKVGANATERFIDVFNKNLGTKIDLFGVPSSF
SVGRITTNVGLDFGPYTPVTSYTGCMSGAKIILNPYPNATMKFRKSFEFDIFKLAQNKPL
TDTDQNPFGASSVPALPGSCGPPLPLPGVLPTVGPARQFFTLSPGLDDSVVLTKVNPIDR
IILLVAIVLAVLFIVIIGLIFWCADRNAREYYRLRNESNTKSSKITSYPKDEAFNSKPYV
VSSSKQKPQQEDDFL
Download sequence
Identical sequences gi|449665333|ref|XP_002164252.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]