SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449665621|ref|XP_002154938.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665621|ref|XP_002154938.2|
Domain Number 1 Region: 627-697
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000416
Family I set domains 0.054
Further Details:      
 
Domain Number 2 Region: 232-332
Classification Level Classification E-value
Superfamily TNF-like 0.000098
Family TNF-like 0.0069
Further Details:      
 
Weak hits

Sequence:  gi|449665621|ref|XP_002154938.2|
Domain Number - Region: 520-618
Classification Level Classification E-value
Superfamily TNF-like 0.000777
Family TNF-like 0.0082
Further Details:      
 
Domain Number - Region: 709-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449665621|ref|XP_002154938.2|
Sequence length 880
Comment PREDICTED: uncharacterized protein LOC100203660 [Hydra magnipapillata]
Sequence
MIRNQHMVKRSFTLSLVGPIKLSKEDKTNLVVYSNFSGSLHVAKFSSFSIVLINDIDDNS
AKGFLVNIPKIIVRKTENQLNLINGWSSECPSSGCFECISKDNPVILNLEKVVVHYGGTY
VLSLQIHLKNKVALESYQLVIKFDELILVCDETAEMYNEVSLSCLFVLLMKKEDEFSVLI
RSRADVTDQNFFTDKFDILEKGYLSIYLLHDEKSFQASSFFLKLNPNNLEFSDSLETLKP
WQQETSSYYCLTCGYSASSGVLTAQSSGCYFISMEVTFKRSLGDVNLSIHWFPIIKDEIN
VFTAVSSVSTSHILKLHVVGFITMDKNTQLSSSFHTSSFGLLVPRGTIFSYTRVSNYPLE
TCETYIKLSAFISTLKEHSIITEWVPYSSRSLKADNFPLHRSGVYFLSANLITLSSSGTR
ISFGVLNKLNTLFLATYYSVPDTTFTFLLAGVVLVKTSKVVLSIYMSSNNTATIQSQTTL
SLAYIGGIKSPAILLTVKSPESHHWIAFKWVLITAFEEEHVSGFFYKNKVVVPKVTGLYL
ISAHVIVSVLMPVQLTFGIFVNDELTVTDLKQLISVDTLTVSRSMYLRKGSVVSIMMYSN
SETKYQVETRSSFSMVLVEQLGSDIIQMPPVITSELHLGSYLELAVGMECNLECNTVSNT
AETFTWYKDNQEITGHNEKILKNCLLGSGFYQCQAKTDNIGPVSIATEVLINEVNECEDK
ENCKGANMTCIDTPLSYKCDCLYDLKYYGGQCVENVTVQTKSREHQASSIPVTLFVMVPA
AVLITILILICSVFLCLKWKKSREDRSDMEFLQLDLTEEAIPMQSLNVSQVLESPDIDKT
STGTSISYSLAISLSANDEDEAEGFEELKWRKLSDASTFV
Download sequence
Identical sequences gi|449665621|ref|XP_002154938.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]