SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449666360|ref|XP_002166874.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449666360|ref|XP_002166874.2|
Domain Number 1 Region: 22-184
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000019
Family MAM domain 0.082
Further Details:      
 
Domain Number 2 Region: 555-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000622
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 189-295
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000392
Family Growth factor receptor domain 0.021
Further Details:      
 
Weak hits

Sequence:  gi|449666360|ref|XP_002166874.2|
Domain Number - Region: 301-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000675
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number - Region: 414-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000913
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 484-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449666360|ref|XP_002166874.2|
Sequence length 773
Comment PREDICTED: fibrillin-2-like [Hydra magnipapillata]
Sequence
MLATATFVVLLSLVAGQERLLFYCGFETDTCSLDTALQPLTNANAWQRTNKKTPSQNTGP
SFAYNGTFFLFFLSSLPNNINSSNLPLTLTLSSSATSLRLKFALHAYGSDIQSFNIRFFN
ANMGLLRDDQVLSGQLQASSDAPWTVVDKTYTFTSTVMTIQFVVGCTPYKFQANVAIDDL
SVYGSGSCGTCGANAQCVTNNNIQQCVCLSGFTGDGYTCTPTVCTSCSANAQCLNVNGAF
QCVCNNGYIGNGNICTLDICSTCSANAQCLTVNGAQQCVCNNGFTGDGKICSLGCGVVGR
TCGTNAQCVSVNGVQQCTCLNGYSGDGITCTPSVPSVCNNCNANAQCLTVNGVQQCVCNN
GYIGNGITCTFDICSTCSANAQCLTVNGAQQCVCNNGFTGNGNTCSLGCGVVGRTCGTNA
QCVSVNGVQQCTCLNGYTGDGITCSPSSNLCGSVVCSPYADCVTEFNLPVCRCRQGYVCG
DKCVTNGLCSNFATCSVVNGLEKCTCAPEYSGDGLSAPGSTGCKSKCELAACPMYSSCTL
NSAYVASCQCNPNFFSNNGVCADVNECLTSGWCRGANTYCLNSIGGYSCECQPNYLVNAS
TSGRDRSCPTFQTCSIGKTCNCTNLINPTSVPSITFFYGVNDANPATALQFLNIWSDANV
KAYCKATGCDQGMLGDIVANITIYVKRADEMMSNSMNAMQQVRDYINCNSYEALEPAWWN
LYDVLSSQYIVFKQVRRDLDMKLTFMMDESKRCETTNADWFRKYLEWLSPVKF
Download sequence
Identical sequences XP_002166874.2.79663 gi|449666360|ref|XP_002166874.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]