SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449666362|ref|XP_002161135.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449666362|ref|XP_002161135.2|
Domain Number 1 Region: 21-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000364
Family MAM domain 0.025
Further Details:      
 
Domain Number 2 Region: 365-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000749
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  gi|449666362|ref|XP_002161135.2|
Domain Number - Region: 180-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000137
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 183-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00091
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449666362|ref|XP_002161135.2|
Sequence length 583
Comment PREDICTED: uncharacterized protein LOC100209198 [Hydra magnipapillata]
Sequence
MIAAAIIFGLLGLVAGQNRLVYYCGFENDLCGLSGNENAWLRYNQKTPSFNTGPALAYAG
SYFVYFESSDPNYQSSLNLPLSLTLPANISTSAVRLQFALYAYGSSIKSFNVLIYDNSGV
LLTNDQILNSQIQMDSFSPWTIINKTYTFSSIVRTVEFIVNAEKWLADVAIDDLSIYAIG
CGTCSINGLCQNTTNGQQCVCRNGYVGDGYTCLPNCLSPCDPIKATCVVSMGVASCQCLP
QYGSGSGLASAGNSSCSINMCGSTQCSPYADCVMDSGVPVCKCRPGFVCGANCVTQGLCS
NRATCSVVNGLETCICGMEYFGDGLNAPGSTGCKSKCDLLNCGLYGRCVLNSSYAATCQC
NDNFMNNGTYCVDINECLTPGWCRGANTYCSNSFGGFSCECMNNFAPDMQTSGRNRSCSI
NQQCALGKTCDCNNIISPITVPPISFFNNVNDANQNIARQFLDIWSSQNVKLYCKMAKCN
LKMLEELIANITAYTSQTNVMMNNANMAIMVVRDFINCNPYEMLDPAWWSLYKKLNDQLI
TFKQVSIDLDMKVILLKQESARCEEVNSNWFRRALEWFSPVQY
Download sequence
Identical sequences XP_012567151.1.79663 gi|449666362|ref|XP_002161135.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]