SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449666537|ref|XP_002168386.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449666537|ref|XP_002168386.2|
Domain Number 1 Region: 315-464
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.59e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 694-786
Classification Level Classification E-value
Superfamily Immunoglobulin 3.82e-17
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 874-974
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 978-1076
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000014
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 1064-1156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000182
Family I set domains 0.0097
Further Details:      
 
Domain Number 6 Region: 778-878
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000242
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 1158-1215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000862
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 8 Region: 609-689
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000017
Family I set domains 0.022
Further Details:      
 
Domain Number 9 Region: 36-132
Classification Level Classification E-value
Superfamily L domain-like 0.00000000765
Family Ngr ectodomain-like 0.04
Further Details:      
 
Weak hits

Sequence:  gi|449666537|ref|XP_002168386.2|
Domain Number - Region: 1235-1266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000284
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 466-564
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.016
Family Ricin B-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449666537|ref|XP_002168386.2|
Sequence length 2149
Comment PREDICTED: uncharacterized protein LOC100201272 [Hydra magnipapillata]
Sequence
MYFITFLILVRLLYVSLLDINECQSKWVPEIRGGYIYQVDCSNLGFKNVPENISSLTSEL
DLRGNDITKLEETVFKDNQELKKLHLSGNKLHCDWSIWWLVSFLKKLEFFDGQCFTPILL
RGRNIKSLTLKDLEIDCLSVSKLRNAVLDGDYPMTVFRKDKSTTEVVVYCHKMSSTEPKE
YLTLPSGEKQNYVEVSKQCDSVTDQGLKEMIEHLTALHSNFTRVRLFLNNLTLSTTDTTF
STNPSFFFGQPSICGDKQCLSGRSSSDLRGTPFYFKSSKQIIMLNECNTQCGKCDIKTSL
ELDFIDSDRQPFLACTRPIGMQSNKILNQHITASSNAGQSFAPHYGRLNLPNGWCSGSND
VLSYLQIDLVKLTVVTGISTQGHPDRSNWITSYKLFYSKDDEEYQVYKEFGEDKILEGNI
NSNSVVTHWFLPTIQARFVRVNPSAWNDDMSEHKLCMRVELYGCLNVFSSYLIQNTDQQC
IYSDIIGNKEEHLLKMNSNCAGDKYMFTFSNDKVQHTKSGLCLSINSESTFILTSNCATT
NLMFQTVESHDMFLIKDLNGNCAKIFGNVQNRFLNAIWLKCESGGFSRLRLTNNGTSAIL
PRFNEVLVKLNIKMFTAVKLTCEAHSDPISIYRWRNIQPNANVVKYDLMSTTRISFFEFE
NITWEDGGLYVCEAWNFEGFATKTFDVFVQPIQWFHTKPSNQKVLYGNSMYFDCISQGYP
EPKVSWFLMNGDTNSAVVSDDRINIFQNGTLFIKSVSIVDEGNYTCKSSSPRLEATVFAT
LDVYVTQSFIKVPELQKVLYSHDAFFECVSEGQPKPLVSWYYKLNGKTNEIKNSYKYFIS
DQNSLTVCNLTYDDIGEYICVSKSPRLIRNVSAELDVYVTQEFLVKPTDANILYGSDHIL
DCNVTGVPMPHHLWVFNSIFDNDQGTIISNENNQVFPNGSLVIKNVTIKDSGNYYCVAYS
PGMSTNVSSKVNVIVTQKFTYVPTSQISLHGHSVLFDCQSEGIPPPLTSWYFHSLNSNKP
EQIVLNNRYSILHNNSLLVLNAQDADEGNFICVSTSPGLITNVSAQLYIYSVPKITLSAV
KSNILVGQSIEIICNAVGDPTPIIQWYKLFDNTEEIPISNKERLIFLKSKKEDAGTYICE
AKNVVGIDRGIFELQIQATCSLDMIENENYIIEKHVFVENEVVFIKCKDGFRINGSSHLS
CLESGSWNETIPLCDDINECEGETLYNDDNSVNKNTICDVNSQCVNNFGSYQCQCNEGLF
MVNSKCEHEKIATNYKVITTPAPQSFFWLDNLMAKYKNSIIDEVSYLQALRKNFGIISKL
PYYNWRLDAVSRLIESLHLAVQLSNEVIFNENQKDKSVNCIQIFAASVSSVLTLDLKTEW
AEINKKKNGSILLMKYTEEYVVNKVRPIKKNQLTDLFAITFENLDINIQPVTTYHKDEAL
KFSMIKDSVGVYVKVPNTNYPVIESSMSIAIIYKYLDKLLPKVKVENVLSPIIGSQVFSF
SFSHLSKALIKPLEIRFKLNQVVGNGIQCSYWDFQRPYSGGWASDNCKASNASSNLEILC
ECLHLTNFAVIVPQALPYSENRVVNLKFTLTAAVGVLCLLVLAFLICVSHICCSSYWKSS
RQTIICNLNLVLILSIVAFSGGVIMSYLQLVPQTLNSYFCFSLLGTIQIMGVGIPIVLLT
ISVVLVYFNKFNLQLRCTLHRFSFELVGIAVGMPSLILILATLVMHLVIYISIRRNKELL
NPYVVIHTRRALHFSKALLLIHVLLLGGVTTFLHFNSNTLYHHIFGVIAIIEGIYLVIYH
GFFDRKKAGIKSPKLRTSHSAKDTVVTTVSGNHGSTLETLASSPLEQRKSLLKPLSKNLP
SSDSAQGLSHATRTIESSSEQLEWDNSFADMYGVQSVGQSSEMKPLLNTQVSHDIPEIIY
EENLARLSHSTFDSNHKYESFNRNANSLPRRKHRNLEIDEYSNDGSYKNKKPLQHINSRA
SSIVSIEKHSSGAANQVIPVYFPVAPPHYEMTMKNDEESSDVFPDSTDNSCRDSPDASCR
ESFVIDSNRMSTISSELTNILFELQAFNTKPNNVKSSVSLRDTIDTNLDKSSTFRPQGQK
TKTMIEKDQNITKQLQTDNNRIRGVRGRTRAEADPSDGYHAISDNYGSL
Download sequence
Identical sequences gi|449666537|ref|XP_002168386.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]