SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449666908|ref|XP_002154505.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449666908|ref|XP_002154505.2|
Domain Number 1 Region: 176-367
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.55e-35
Family Pentraxin (pentaxin) 0.0033
Further Details:      
 
Domain Number 2 Region: 1023-1130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-21
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1132-1237
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-18
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 4 Region: 847-916
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 548-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 963-1025
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.01e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 906-968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-16
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 8 Region: 671-740
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.67e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 729-798
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 788-852
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 11 Region: 46-171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 459-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000328
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 17-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000899
Family EGF-type module 0.022
Further Details:      
 
Domain Number 14 Region: 498-550
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000298
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|449666908|ref|XP_002154505.2|
Domain Number - Region: 2-19
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0458
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449666908|ref|XP_002154505.2|
Sequence length 1247
Comment PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Hydra magnipapillata]
Sequence
INNFTCICQENYKGKFCSEKKPMCDTKMCSNGGTCYEIPDGIECSCAPGLTGKYCEEIID
ECASSPCKNEGTCVDSHRGYQCLCKSGFTGALCQDNVDDCYNNACLNKGVCIDGVNRFSC
SCVKGYSGERCEINVNDCFSSPCRNGGSCIDQVNGYKCQCPSTFSGPTCETRNAVSNFDL
VFDRTVQGYAKSTINELIDEFTVAFWLKTSPTEIESGTVLSYAIGDSDSFVDNALVLGNM
NHVMLNIMGEEAPTNISVADGSWHHVAIVWSSKSGKYQTFKDGIKIAEDINFQKGKAIPA
GGVFIIGQEQDEVGRNFSASEAFDGHLSQLNMWNYVMTENEILGMSSYRCDMLFGNIVAW
ADFNNPSIDVKKVVGFCTNSQSKFHPWSTSQVIPCPGQVISAQCLTLDKMGIKELNLFGA
TCTTKGFFCSNADQKKFDVNNNVVCPSQMQVRFECPYTGVNDCLFNKCNGNGLCIDTLQG
YICRCNDGFYGKNCENELPCTSLQPFVNGIVSQTNGLVTISCRPGFKLIGSSSLHCVKGK
YNKEIPECIDLDECLYSNGNCQHKCLNTIGSYLCQCNEGFEMQGSTCVDINECLTNNGNC
QDKCFNTYGSYSCQCRAGFKISSNLRSCQDIDECVGTHDCSQLCVNTQGSYKCQCKPGFV
LAGNGKSCQKILCPQLNAPTNGYVSHSTGDFGLKATFTCEDKYRLDGSSQTVCGADGKWS
GILPRCKKITCGTLPSPYNGQATLVGAGLNAEYRFFCLKGFLLFGSETRTCRYNGSWSGD
QPRCVPYNCPPLTKPENGVILGSSLNQGATVMIKCEKGFMLSNKNLNYRICQVDGKWSHN
DAQCVPVSCGKPEALDNGTFTGSSFKIDDVITYKCNDGFGLSGPFQRTCLLSGEWSGISP
KCLYNSCGYPGLPKYGILDGTVFSFGKTVNYSCSSGYKLIGDTSRKCMLSGTWSGTLPIC
QEITCGDPGFPENGLRLGNSFSINATVLFDCNAGYSLKGARSIVCGLNGVWSNLLPQCKV
GLCGSQKLVGPSGTITSPNYPNSYSNQEYCRWNIVMPLNKKAVLDVRTLKTVGPNDRLEI
FDGVSQNLLTVLHGAIPQSIRITSSSNVIDARFVTTGENSADGFTADYTSSECGGHITTI
GQVITTPNYPSNYPNGIICTWQVMLPNNNIVLAFEQFNTDQRDELEAWSSVTSLSAHAKI
GTWSGNRGSFLTIDSSGIMYLKFSSDDFHSNVGFKAVVKKRTGTINA
Download sequence
Identical sequences gi|449666908|ref|XP_002154505.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]