SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449667417|ref|XP_002166064.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449667417|ref|XP_002166064.2|
Domain Number 1 Region: 19-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-28
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 2 Region: 215-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000173
Family Laminin G-like module 0.0094
Further Details:      
 
Domain Number 3 Region: 392-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000629
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 423-476
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000404
Family Fibrinogen C-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449667417|ref|XP_002166064.2|
Sequence length 1102
Comment PREDICTED: contactin-associated protein-like 2-like [Hydra magnipapillata]
Sequence
MRNLFMVICCFFLNNFFLINADESTASFTGNDYIRYEITNKQETRKDKVTMRFKTTEAFG
VLIYSCGIQGDFLLLELQRGKLVYTGNFGSTLEEYGAHKIIHEKQYNDNSWHDVVILREN
GTHVYFTVDDKTKSYISHLDFEQLNLDYLYVGGLGLAQKDETTCLNIKEKTNFIGCMSKV
RFNSIDLLYGAIEKFTHFKTFGHLSFTCPDSKLNIFGFSSVNSQMTLRRNILNVNELNFA
LELRTFEPNGQIATHLCTNGAIEIILVNGKLNLIVSFIGLSAHNAVTIKSEIKVDDGNWH
VIRISVQRNEDIVKLQVDHVSEIHQFKSYFRLGSTDGIGNFMGEITIGGSTPELPCLLAC
YRTIEVDNEPVLFDSSKIIKKREVGKNCNISDLCFPNPCLHKGVCFQSLQTYTCNCTNPD
YSGTNCETCVYKRTCHELMDSGFTESKNYKLCSNNEQVYQAYCDMSSGETIIGHNIKNDT
RVDEGEKVEGTQSFYIHPVKYSVDVLSIINLMELSSLCKQYIRFDCFQSKLLDGVGRKRY
DDYKGARWLSRDSERQHFWGNSNPDRRTCSCGMDKSCAKGDDGKPYDCNCDAGDAKWRFD
DGYLTQKSLLPVTEVQFSIGKSMNIKSYFTVGELKCSGTKVKPSDIPVTTMTTTVKFEKP
KIINNSMFSIRKFDNVTILTLPASSSSVRDSIDTLFSKPWLITIVCIGVLLCLLLVVLVF
ILFRQNLGSLLIKCVYGKHVNKPKIEIEDYNRYSTVTENQSDWDIHHLSTTFPTSTPAPS
YGPTDDEESTVDIRCRTVDDLRVKRSLKKLTNWGSRTASAPTVMGSVNSLQYKNDNVQAP
THNEVISKPNCKNIFGSSDTAFSTTATDGEAESIIDSSASEYSQKSSSNSVKSSLKESEH
ESPLGNKKLTDVNILNKNENNEKLQKSNDKFYCIPAPMPTMYSEPMKNLIPITPLPLNGY
RNLKTVRCGLPYEFGGHLAIINNNSNRCQLKNASLTRIIPVRRVSVASENYKPYPHPTIQ
ERCEETTDSEHDTLHYFYDNLCNSDGFYDNNDGDQGFSPSSETRPLFDEINSRDEQEREA
DEQIKLLKRKVIEKATSFDEGY
Download sequence
Identical sequences gi|449667417|ref|XP_002166064.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]