SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449667997|ref|XP_002160669.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449667997|ref|XP_002160669.2|
Domain Number 1 Region: 491-630
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.81e-34
Family Fucose binding lectin 0.00058
Further Details:      
 
Domain Number 2 Region: 639-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 766-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000369
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 4 Region: 810-889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 5 Region: 872-937
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000945
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 222-311
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000014
Family Ricin B-like 0.029
Further Details:      
 
Domain Number 7 Region: 1174-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 1332-1374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000712
Family C1 set domains (antibody constant domain-like) 0.087
Further Details:      
 
Weak hits

Sequence:  gi|449667997|ref|XP_002160669.2|
Domain Number - Region: 322-415
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00027
Family Ricin B-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449667997|ref|XP_002160669.2|
Sequence length 1516
Comment PREDICTED: uncharacterized protein LOC100201520, partial [Hydra magnipapillata]
Sequence
MVWGSMAYKGVGKLQFIDTIIDQVQYRSILKQNLKSSQKHRLGSDFTFQQNSDFKDSATK
TMEWFAENNVEVLTEIFEIGHFPKKMSIEETWEKIGPEEAKSLVKSMPRRLEAEIQAKGG
PTKIRFELGLGQKLNGFMVGAAIDLTIFGQRQNFEFQFDLKNPVQSIMNAKDGGLHRYKD
GVTQLRTAPTFNPYDRPNPFSDFDISGTFGIESLRTRSESRLGACIAAPTTDINEEMVLI
ACNDTDERQRWTHTLHGMLINLYSKKCLALPDMVDGKLFQSDCDSQKHKHLMNIECDLKT
KTLKLRKKDLCVTTVITSEIGPGSIQHHGSLKCIHISPGNKLVLRNGCQQTTTEFEINQN
GHLYFRFNGWCVRVSNGKAISGASLELIQPSLGCDSFSFTKQGSLQHMSSRLCVQTLQME
MIPRDFTELVLGKQCEYVSSLKDSASLPDLQMTFTFVPQNNKLFMMECGELWNMKFEQRF
GIMHDEINTVCSKHWPDLALNKIAVQSSTNRNGFADRAVDGDFNFQWEKGSCTLTNEEVD
PWWRVDLGNEYIVTDVTIVNRGDRGDYLTNFQVHVGSNLVVRQNPVCHDIVRYAGDAEAI
RLQCNPPIPGKYVGLQMFGTGVLSVCEVIVASRLGSLSDYCQIENGGCDQICHNECGSRK
TTCSCRPGFKLAYDGKSCFDIDECLINNGGCRTDQHAYCKNTPGSFHCLCFKGFIHKDNS
LTECADINECGSGNGGCEQMCNNTLGGYLCTCRKGYERKKKDMYGCQNINECLINNGGCE
HNCNDFDGGHYCYCRPGFKLMEDGVSCEEVTCSTLEVPQWGVVSPSICTKRFENLNVGIV
CSFQCAKGYEIKHNFNATSLLCGTDGTWNSSMPSCYPEKCPSLVRPENGGLIPSRCHSSG
NGYNEFGQRCVAYCDHGYQLQGPATKYCLSGSVWSSEDVVKCIKVIEIPYLNCPNDFSLT
LPPDKNTVSLGSDWVEPNTNINFTKISVQPVGIGRSYQFRAGQTVVSYNAIHDSGSLFSC
SYVVHVKDISPPVLLSCPSDIVIVSSSSRESISWTPPTFTDNVGVTNLILPRWKPGNVWE
SGEYRKLQYDAYDAAGNKQTCSFTITLKSLDCPTLYGDNNTVVTTFVPQKRYSIVCLHQK
TLFGNFGYDGSVIYCKDGDYWIDSVKIGLSIPECVSYTESSLNQICDTGSEKFLYEDFFG
ETIYYCAVCPKGSAYNSTSKKCELCPVGSYQDQYGKVECESCPRGSTTKQIGARFEKECL
SQCKPGYYSSSGIDEDNESCVACSVGSFSDIYGATSCQVCPDGGVTLMSGANDKNLCTKP
IKITQVLPGLKVASSVGSSITLKCYYEGYPLPAVFWSKSSVNMNWIVVFYIFNWFIDGAF
CAEEPLNSLNELKELSQTVIKSEKIGLSTEKQKEDGVINTLSKVVSVAENVKNKVYETKK
AGEISKSLKEEIDVTFGVAKGLVSIVEGVRNENFLNVVTGCLGIISSILMLTGPPGAIAG
AIISLVSFGLSAFFAK
Download sequence
Identical sequences gi|449667997|ref|XP_002160669.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]