SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449668161|ref|XP_002161694.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449668161|ref|XP_002161694.2|
Domain Number 1 Region: 847-975
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-16
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 
Domain Number 2 Region: 470-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 536-554,1433-1550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000534
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 346-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000271
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 424-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 565-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449668161|ref|XP_002161694.2|
Sequence length 1576
Comment PREDICTED: uncharacterized protein LOC100197510 [Hydra magnipapillata]
Sequence
MSTDKDMKKKGRGSVEIKTCQNDGVELRAIKWFDNRSVNILTTYESVVPTTQVRRWDKKE
KKEVLVNCPSAIVTYNKCMGDVDLLDGLLSYYRIPVHSKKWYHWLIWHFLDVSSVQAWIM
YKKDSANDKKRCDCDAGASLSPYICDKVTGVCSCRAHTTGRQCKEVEQGYYFPDLYYIQG
VRNLYTNPQSSLQTTLVIPQDSLYYLRVGYTLSSNVQVKLFIELKKFSTKEVVFGIKPYA
DINLCSDKECYGTFFANESSQVYNLQAGTYDVAITSSFTSTFLLLERVVAIPAEFITADV
LFENDRKQYLQNCGDNNLRIGTTDEAKCLAAVYSMTIKFEDGALPCGCNSVGSVSNICDK
YGGNCQCKSGVGGRDCSYCLPGFYGFSRAGCTACNCKGTDKICNPISGICNCPPNTRGRT
CEPCACNGNSDQCTRDGICLNCQFNSMGNSCQFCKSGFYGNALINQCLGCNCHIFGSYNA
SCDMVTGQCYCKPGVVGQTCSKCAPNYFGLSPSGCSPCNCNAFGSSEQQCNNAGQCSCFT
DVQGLKCDKCKVGYFGLPAKPCSPCECHLVGTILNTNCVNDIFGQCSCKPGVEGRDCGQC
QKQYSDFGINGCKQCPLCTRKLQLYVDSVDNQLEDLEEQLELTQNLTDLQTELKLTQAKK
QQVELNAIYFENRLLQGQKDFAILHNDKLIPWNMRLTDLLNEMTFESSERMTSIYNAAVQ
GDKMSKESDSFASAVFSYLVYLNSLASDFVSKAYSYSQNVPTFNLESFEKIIDRDLKLSN
DLLTNITNMAKDSLLNTQKDFIFSTIAEQSNISQYLSQTDGLFQQAYSVYEKTFMQTQRI
TGSIEVMFMQYNPQNSMVRVNVLRGYQLVARDYPSMTSNPFFTLRISPSWWDQGTLESAP
KQATLDPIWDWPVGGTYTFFFTSEHMKLTKLIITVLDYDEDGNNDFMGEVVIDLAIILPI
ISQSSVQNTYTLNPQGYASRWLDTFPGPGDNSILDLQDMLKSQITTVTDNLNDLSKLQTL
ADAQANKLQKQAQDLSNTFDLAKQYASKAVNAVNAYNQIYQLINSSLLAAASASSSVQAF
TLLLNGISISTFTSKTDTELLAAQQFLSQTRSRNISRAVLQIDLRSETLGSSGVNVPPRS
SILINNIEYHPNINGHTVMVLSYVSGSVLGIKTFRTDINQNAGAEFLNYLINIPPDVIVI
IVKQGEGSIASFYQASVITQLIGLGGQVPYFSGNRGSYVLLGYKKTNTDTFPWVSQDLKA
ERLGISKITTLNDLIEIANKTFLAALPQWDEINSLFPILKLKTSELAAESSTAPLVQAAL
DSANVVISQSAVSASKIFQLTQNLLGSVDDLSQKFNYLASASTNVTNVIAEGQEIVMTAE
YKLQFQQKNVGDALNIISSASYNSKIEQKQSELDFKLSQLNTIASKMPFTIKYMEGEQSS
YKLTMLNSGYTEQRRFMTVSFDFIPFNNNGILWFLLSSPDSLAGSMGIYIKDGFLYFTYN
LGRGAITEKIRDVRLGEWSYINVAMILKDVTVVFRDSYGSTTVIKMSSPYYNDKTYMTFD
SYSMWYLNGFPDDVMV
Download sequence
Identical sequences gi|449668161|ref|XP_002161694.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]