SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449668686|ref|XP_002159250.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449668686|ref|XP_002159250.2|
Domain Number 1 Region: 435-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000105
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 538-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000119
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 689-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000778
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 363-421
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000319
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 653-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000449
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449668686|ref|XP_002159250.2|
Sequence length 818
Comment PREDICTED: uncharacterized protein LOC100212257 [Hydra magnipapillata]
Sequence
MHFHFSNISVFNFQDQISLCVINIFDPSVSMFNISEEIISVKISKTASSFSLSYIPEMKA
SRSWAMNIFTPEVIQVLNKDITLQSWSDPENQLSASASGDYFVKTSGIYLLKSKFNLLNL
NGSIEVSFVGKNNAKICVSFLNGGINCSVEMNCFTELLLNDAVSIVLKSFDAPLTVDIGS
LRIANLITTNNFGFGKTLLSEIYLEPLPDNWYSIGPWTFNKTGYYGLFNKKFQSFENQSI
VLLQGTYQVVVNLIVDLRKSSFLGNHSIQLMSGLFLDNELLISMFQQTLFTAQQNVMTIN
LVGNLIMKKWTQMEIKIKLSSNANVTLLQTSSWGVALIENSPFSNTSDKGPIMLTKFSPA
NYSTWVVGISKEWKCEASGDGNLAYIWYKNNEIIDVQYENIGYLKIAGNINDSGSYSCVV
QLDNINVSSNSLYINIYDIDECALKMNNCSTNATCFNTPGSFFCQCNSGFSGDGQLCNDI
NECLLNTSCALNAICENVPGSWNCNCQTGWNGTNPKNNCTDINECEINSNICQKVRSMCI
NTPGSYNCICMEGWRNDGVNCIDINECLEENFQCDINAFCLNTNGSYNCICNKGFEGNGK
YCENINECLPEYDFLRSIDNKCVNNSVCVDTIGSYTCNCQNGFEGNGTVSCNDINECDNP
TFCNANADCINTMGSAQCKCRTGWTGVGKQCTDIDECLESNNCKNGNCSNTIGSYTCVCF
TGYQLNGVTCQSNNGGSTAAQTSCGDPKSYSCMCADTKKRDNNILCNGLFLALIILSVIA
IIVVLFVVKYMKSRKLKKIGPVKVQRDKYIEMENESEL
Download sequence
Identical sequences XP_012554573.1.79663 gi|449668686|ref|XP_002159250.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]