SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449669331|ref|XP_004206994.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449669331|ref|XP_004206994.1|
Domain Number 1 Region: 195-393
Classification Level Classification E-value
Superfamily vWA-like 1.27e-36
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 2 Region: 567-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-16
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 507-572
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000292
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1098-1245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 5 Region: 625-686
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000917
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 1263-1304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000499
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 860-916
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000032
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|449669331|ref|XP_004206994.1|
Domain Number - Region: 410-539
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00194
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number - Region: 1301-1320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0321
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449669331|ref|XP_004206994.1|
Sequence length 1329
Comment PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Hydra magnipapillata]
Sequence
MVGISFGSVQGILKDHLGFRRLKSRLVLKFLSFFKKECRVKACEAMLSDYQDVYKQIITG
DETWVYAYDSETTDQSSEYREKGEPRPKQPRQSRSKIKVMLTVFFDYCGVVHYKFLPTGQ
TVNKEYYLSVMRRSREAIRKKRPESWANNSWILHHDNAPSHTALENRLKMDTFFNFVIIF
VCIFELTHSTRDWRVQRLNQFQQQYNNSKADIIFLIDVSGSISDDGFNTEREFVSSLLSK
ISVQPSAARIAVVTFGRDINKDIDYIDYGYLDKNKCTFNEEFKRVKHRKEGWTNINGALQ
KAKALLDSANEKKFKRHNVNTVAVLLTDGGWNYGGSPYDTATNLRTGFHYVDIFSIGVGH
WLDRKQLKNIAGKEENVIIAKDFSDFSGLATTIRGDQVESLYQVVDISRCGITCDVNARC
SCGTISGIYTCACLHGFYGSGSPGRCYECPLGTYKKYPSPDPCIPCPKFSTSHKTGSTSP
ANCVCFPGYTGHPEVGLPCVPKQCPKLPSNIVNGQVSSCGTLFSETCTFSCNPNYHVANE
VAVVTSRKLTCTLDGQWDKPVPLCVVIECANPHDPPNMEVKCSGFTVGSQCGFKCKPGYI
LEGANMRECRSNGLWTHDMPYCRIVTCPQLRKIDNVNVNPIKCLNEPTDFNDACSFSCKP
GFQYISGEQNRVCLQDGTWSGKELVCLDKTPPSIRCPEPVLAESEPGRAYKEISFLPPSV
IDNSISGSDDITVTQSPSNIVSPYEFPIGITLILFTAVDTAGNSDSCTFRVEIVDREPPI
FTYCPEDILETTTSAIDKHKNVAWSLPKFIDNSGYVNLTYSSHESPHKFPVGPTQLIQYD
IEDSSNNRATCEFFIKVESKTCPKREPPINGAVGCQYVGGMGHMCSVNCQNPYTFNGPLA
FSYVCTMSGTWSTIPPGFRDSMWPDCTAMQPQEGMGQKMKFFYYSGNCHDSFEARSIIAD
NFVKLLDRVMRNEGGCANAANARVCQSENVEITCGKVETINGRRKRSLQNSLEITVDINI
RSKENSTVQEHAVESLSQKVKNLKNDGTLIANQIKVMHIDGDSLVLNHIETVGLVTGVCL
DGSVYDRLEQKLGQFQKSCVSCVAGKYFDRLHRVCLDCPKGTYTETPGRLGCTSCPLGKT
TQSVGTFNSTHCKEPCAPGSYSNTGLEHCHLCSKGTYQPKPYSNECIKCPGSSTTLSEGA
KHLEECGMICPAGTYSKTGVEPCYPCAMGFYQPWVGQTNCIQCPGLLSTHITGSTNELEC
KVIDNCISSPCMNGAVCISEWNSFRCVCKLGFIGKFCEEEKNECLDNPCYHGSACVDGVT
ILTYSYINS
Download sequence
Identical sequences gi|449669331|ref|XP_004206994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]