SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449669716|ref|XP_002161535.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449669716|ref|XP_002161535.2|
Domain Number 1 Region: 73-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.061
Further Details:      
 
Domain Number 2 Region: 587-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 231-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 683-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 5 Region: 122-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 6 Region: 178-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 7 Region: 537-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 8 Region: 284-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 9 Region: 636-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449669716|ref|XP_002161535.2|
Sequence length 842
Comment PREDICTED: laminin subunit beta-1-like [Hydra magnipapillata]
Sequence
MPSVGKSISYVPRRDDYVATEVLKNGIVRDYYLATNIRTVLNTFFMPSEFDRSVADPRKF
YFAVRDVDIQASCVCNGMSNQCSPEDYGTCICQKNTDGKNCERCRSLFNNKPWTFGQPCE
SCSCNSHSTSCVYDATKKYGVCQNCMDNTMGDKCDLCAVGYYRNVGKQLFDKNTCISCNC
FMSGVLFGSSVCNQVTGRCFCKSNVDGTFCNTCKDGFYGLSATVLNGCNACGCYRFGTIN
GSAVCDKLTGVCPCKIGFTGRTCADCKPLYFSYPTSNPSECRPCNCDPSGSVNMTCDKSG
QCLCRQNYFGSRCEQIRTGFFSASVGQLLFSPQQVSSPVAYFHEYINLTEASGNTFYVLG
YSVSIGKLDTSATLVTFQINVPKTMLYEFFIQYKCRDIFSGLSMQVTIESQFFPYSCDDG
TMISSSLAMTLSGSLDPDTQTQSFGSLCLSVGTYNVVLWFPPGSAKNGAKVFILGLLLMP
FYESQSRYLLLDSDQKTTFKQFYSVASSRVLWATQELVGAKSLAYSYGSIYEQALACGCN
SLGSINSYVCNIYGGQCNCKENIYGRTCMSCLPQYYNFSSGLGCVPCNCNEDGSLNQDCD
YNTGQCQCNPNVIGRTCNQCALQYFGISTGSGCKPCLCSALYATSSQCDESGQCQCKPGV
GSLKCESCAPGFYDLSVSGCKTCLCNPIGTAGNKCNPTTGSCTCKDLVMGVKCDQCTIGY
YGFSSDFPNTCLKCYCSGKTSECDAVSDYYLTSASTLFSTTQNNVGLQGWTSVDIYGKDS
GKLEWDWAPLYSVDRGFAKLTDTNSDTLFFSAPDIFLGSKRSLYMYYITFDLTQSTKHLL
AH
Download sequence
Identical sequences gi|449669716|ref|XP_002161535.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]