SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449670097|ref|XP_004207192.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449670097|ref|XP_004207192.1|
Domain Number 1 Region: 15-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.05e-21
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 2 Region: 234-365
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000409
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 387-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 428-477
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000987
Family Fibrinogen C-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449670097|ref|XP_004207192.1|
Sequence length 866
Comment PREDICTED: contactin-associated protein like 5-3-like [Hydra magnipapillata]
Sequence
MNLGFMMTLLISYARCNNEMVTFDGTQYLTSSLVINPLYKTTNEISINFQTTQSSGLLFY
ASGSTGDFIAIELFHGNIRYVGNSDGFASETQLTIIHSGNFADGFYHQVNIEIGEFTKIY
VYSYPSGNPNITVKQSGANDLRFDLDEVAYFMGMPLNEWRISRNELLTTRNFIGCLNTIT
FNKMELALYKYDTNLFPGTSFVGRLILGCNISTPNFLKSFTSIDESIEIKYPVNSKTLFL
EMSLKTYVQTGIIMKYISSNTYPSIYLYLNKKEFRLDGNLSSLFSFSLLHSDKSNDDGTW
HLIQIEINDLYASLSVDANTMMFSFSKPIVFNLPERLSFGGSFANIPGIIGCLKDVFISS
TRTPITFFLNQSLIISYEEKMCAMKDLCFPNNPCKNGGQCFQNWNGQLCNCNFTGYSGKY
CDIMDNIRYQPSCSSYFQIGYRHSGGYFVKPGSTLPFYVKCKMNLSEGKGTTIIEPVNKE
IFVFTGNTFDDNFFFHSISYKASKHQINNLVAASRECRQYVRYNCYASTLMNSKESYLPS
TQLGVRWYSRKGALRNYWAGGKNNSFSCGCASNKTCIDSSLYCNCDVADNYMRFDDGFFT
EKNELPISKIKISRLRTNHRSSVEIGPLECTGTVNEIEKFNKAPTTSIPDNNINATTFSI
FFTYLTKQSTLHPKNTHDATLLVESTNIANTTSIPINEKESVIVINSKLLYAVVISIGAI
ATCATLLFIVKRCWFTSNYSKARPHVIQFYNEDTSLNKNRNNFHVNNDIQVTNDIKLTVD
HIDVAPSSTRHCVPTYHQNVTKTSEGSEDFLYEKDLVEYNENDEFERKYFPRKGILKIKK
DFLRYSCRSVGIQMAAHSTKVNTVHV
Download sequence
Identical sequences gi|449670097|ref|XP_004207192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]