SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449670434|ref|XP_002165375.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449670434|ref|XP_002165375.2|
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000115
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 2 Region: 173-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 313-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000699
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 15-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 228-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000659
Family Growth factor receptor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449670434|ref|XP_002165375.2|
Sequence length 420
Comment PREDICTED: latent-transforming growth factor beta-binding protein 1-like, partial [Hydra magnipapillata]
Sequence
INECIDSKYSSRKCNWAYGYCTNTVGSYVCSCTGSWILSKNNDSCEDIDECATQNNNCNW
ENSKCVNTDGGYTCTCNDGWELGKDSKSCVDVNECNKTQCPNEFCINTIGSYQCLCPSGS
FYDTTLNSCQDINECAALTHKCDALRGICRNENVLQTNRTYNCSCLEGWKLSSGNMCIDI
DECNNTCKGVNSICYNIEGSYNCTCKDGFQFNASSHQCEKVDECRTLSTNQCTKPHEMCS
KITNGPGIECICRQGYEKIAGICKEIPLVTCNTAAQLNVSLCPPDQKCLDKDLGFDCLCP
DGYVKNSSNLCEDVDECKVGNVCSPNSKCINTYGGYKCECNDNYYGNNATNPSLIRCYQN
SLWTSWEQVGKCSQLCKSDGNDGKITFTRKCQRSGPENCVGISTKEELCNTEFCDNSKIY
Download sequence
Identical sequences gi|449670434|ref|XP_002165375.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]