SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449670659|ref|XP_004207313.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449670659|ref|XP_004207313.1|
Domain Number 1 Region: 6-132
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-40
Family C-type lectin domain 0.00048
Further Details:      
 
Weak hits

Sequence:  gi|449670659|ref|XP_004207313.1|
Domain Number - Region: 927-1002
Classification Level Classification E-value
Superfamily Cadherin-like 0.00144
Family Cadherin 0.044
Further Details:      
 
Domain Number - Region: 1587-1640
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family PHD domain 0.069
Further Details:      
 
Domain Number - Region: 840-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0527
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449670659|ref|XP_004207313.1|
Sequence length 1644
Comment PREDICTED: uncharacterized protein LOC101240164 [Hydra magnipapillata]
Sequence
MLHNGLSCPDGWSENKKYCYLFYQASKPQNWNDALLSCQRYGGNLLSIEDQAENTFIKNQ
LKIKNGNYWIGLNDIKIEGMFVWSDGSSPKIFNWRGSEPNNLGNEDCVETNSIGWNDLSC
QTLLNGFICKVIRDPCFGYKEIDDFQRSTAFTVDPNKPFVCNSAFIADWYRFTSGAGGKI
PTTNPPPYSCGTKNPTWLNVTEPTALNETISGQACVVVDNNICAHKVDVKVKKCTKRKCD
TNENSPTGFSPCSSYFPKIEKDPVVTVGVDNKRLRFTCKFHTVQESNARYEVTWFQGPEE
KQIKGPEVFTSNKNEAFLQNTNKYGENTTFCLGYNVTPKTLELSENGKPQKVSVTSTVPI
VCEDGTESCNVLLELGQTKTDSFVDYCSLMFKPGPAGQNQEIEVVAKRDFVDDGNQKMFL
QLFVPDHVDPVDWNCHKQITDVEIKTVDVKTARCTSTGDPHITTFDQFYYNHYYVGDYVL
MQSTARNFRVHVRTFACGSVSCNCGVAAQEGDDVIVIDMCRDSVPRARFASTVEPQPGTS
ITRNNNGKSFTVSFSSGAYVKFNAFHWYGKFYYANIEVQVPSDDFNRTQGLCGTFDKNKS
NDMTAKNGQIYAIKQGQIANLMFTESWKLNVSAENLFYFKGGPRKCTATRAKSYCTCSES
CSGAKRKINCDYEGYSDRPKYIHGVIGWKKLEFPGAEHCARRKRRSMDDNVIILPDDGNT
GVYDYNPNQVFGNVTSFPTKSGITEEKAKDNCKSKIRNSIAGKACIDVIGPLFKTDDYEQ
QCVIDIQVTDNEKVGVESAINNLISACEELTLRNLSFWESGDGNITGPPVIIGQSVCPNE
CNGNGICKNGTCICNSGFITSDCSLKEGQSPLLFGIPNSGLCDIRDQDCVRTRVTGMDFV
DSNSLSCKMTEMKNNNIPPSIDKFTSKQYTFKGQEWSFKIPAFDPENQPLLYSFIGESYG
MKISSDGNLTWTPDKIGKYYFTIKVTDPCGLSNFSNFEVEIMQCLCEGKNGGYCIWQGEP
GNNTFSVCQCPHGCTGELCTQTIDGLVCKIKIKTDQHRKWGGLSETVLAVIIAVLVLLFL
TCPVICGYSGKPIEWDKVLIIEWDLSKQPDMKKMKPNTKLIRKNSLDVEDAVKSVLKGMS
IRDAAEVYSLSKSAVGRAVKMARCQKLLDYKHIVNIGNRKIFHVSEESAIADYLQTSSNM
CYGLTKLQTRRLAYKYGIALNSNSIPESWHQNKMAGKQWLEKCIFNADETGLLTVTDPPK
IISTRGTKRVSQAVSAERGSLVTMLAFVNAMGNTVPPLFIFPRINYKDFMICGAPTGSLG
LCNKSGWMTSENFLVAMKHFVSHAKPSVEHPVLLLMDNHESHISFETITFAKENSLILLT
FPPHCSHRLQPLDVSVFGPFKSYFRLAQNEWLASNPGRIINIYNLPQLACKAYNMSFTIK
IVCSGFFKCGIYPLNRQIFGESDFISSSVSDKPLLVEQPEIKQPDNQQSYEINKQVDSSE
SSVKIVSPESIHPYPKAPPRKDSKKRRKQGKSTILTKTPEKTVNKKNIFETGKITTQNLK
RKIDLKRGKETEIFDADFLIVSSVKNAPVNQQQQNTCKICKCNWKNFVGPAWIQCFTCQW
WICGNCNNNSKKRYYECELCEVDC
Download sequence
Identical sequences gi|449670659|ref|XP_004207313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]