SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449671095|ref|XP_002156913.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449671095|ref|XP_002156913.2|
Domain Number 1 Region: 256-350
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.72e-20
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.003
Further Details:      
 
Domain Number 2 Region: 530-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000942
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 6-69
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000249
Family Blood coagulation inhibitor (disintegrin) 0.00072
Further Details:      
 
Domain Number 4 Region: 584-711
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000374
Family Fibrinogen C-terminal domain-like 0.0024
Further Details:      
 
Domain Number 5 Region: 1190-1243
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 6 Region: 795-854
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000344
Family Fibrinogen C-terminal domain-like 0.0041
Further Details:      
 
Domain Number 7 Region: 78-130
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000142
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0053
Further Details:      
 
Domain Number 8 Region: 1452-1529
Classification Level Classification E-value
Superfamily AbfB domain 0.0000275
Family AbfB domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449671095|ref|XP_002156913.2|
Sequence length 1573
Comment PREDICTED: uncharacterized protein LOC100199215 [Hydra magnipapillata]
Sequence
MCQKNGDDCCEPNNCVLKATAQCNYVINPECCQPSCLFRKQGTLCRGATSECDLPEFCEG
DKATCPNDKILRNGIPCGNFVKFFVGPTGGSSRAIAKLSPPIISRYLRILPKQWNVGKTA
CFKADVRGCPAVPDYINLPTSITSAELYYHSPFCITPSITSCSETVLDGTIIKYIDRDTR
SGHCEHDYMKFLFAADGTLTHDCSKKKEKSLQHIQSKNCVGCSAPGGSWPTHDYAARIDN
WPGDTCTLTYDRKEYCDVPLGMSNKALQESAYTASSVYSDLIKPSNVILTNIGWCPKISN
GSWIQIDFGENVRIANVEMRPTNWDRTTGYSLQYSADNIVWVDYLESDANEKKNLESYCF
SGSCTPSLKQQCRNLWESDALVASDSCWNNLNTIQNGFGTCDSTKNTSCMTSNVKCGQLQ
CYAKQVKPIRKPDYGTDYKQFTYDNQICSGASITESVQGKSGMVLDGTICGENKFCYNAA
CRSADEHGFMTCPIVGGKECSGNGSCASDGTCVCNDGYTPADNCEKKLSPINGAWTSWSV
FTKCTKGCGGGIQQRYRFCSSPKYGGNDCDGVSVEEQPCNTLSCPVAESCLAIKGLLEKQ
GQPLYDGIYTIKPTPTLTLNVYCDMTRDGGGWTLVVSSHSNTWDDKNVWLRNIDKPDLFN
DYSIFKYANELKTSYKIQDDTFNYRLEANELGRWGGVFSAPAKYNISSTNAQQTKVKVLQ
KFDDWQFGSRSIDQRLPYISGYTITTSLIVSTSAYDSWGSLTDNLPGLHPSKWINEYMKM
MFPEHVWYWIREGTYSYPPSCLNLLFRGLSNSKKLESGVYEIEPTSGKVVKTYCDFDRYG
GGWTLLANVVTKDWSLEKIKDLAELLENMKIKDLSEKSYQIMLEANDRDSNGGIFSIPVE
HNSLSCSKLYKPTLLKKFGTWNESVENIAKYPLCIVSDKEFSMAANSLDVGDNYGVIAGS
GKYMTSLENPSFVQLWVREGGSRYSCNDLRVRGLVNGQLYKDGLYMLANNQPAYCDMTST
LNEAWTLLVTSVSNGWTSDQVYSRNAVAPSIYEDFSILNKANTIKKLSNSGTIKYRLEGT
ASKRWGGIWESSTAYLFNATSCQPTKIIKQFDSWDNGSWWQGPYPCLPYLSTDATKDGLL
ITGTADYGGAIISKNPKGFIPSRWIVNLNDNPGVIWYWLNENDCDSNYKPINGGLSPWSE
WTSCSVFCGTGKQSSQRFCNNPLPKCGGKECDSVEMFREQSCVGSCLTTQIRTFGDIFCI
EPEVGGCTVADNTKLVYRPVSSFCKNEASNFVYNPKTGSLLHKCSGKLVCAKDGIKNYSP
IVISSTCKEFTSASQIQRTPWQTNQMESLCFEPNGGYIANGVFLNLWGGCMSANQMFVMP
GIEIHYLIEPYGLPNCYLDLDLTSIGKFMTYNCNGGLKFLLVNESKSHLKLNNCEAEFLG
SVLFLFEVERINGDGVSFQSLADKTKYLRHYFFVLRLNTLSEVNNKIGDQQFYIHPSYYD
SYVLLQSTNYPLKYLWRNNLQFNIDDYKDQVQSLSSFKLLVCGKILNLIVDNTGQQRFCG
KTFGGHFIGNLLP
Download sequence
Identical sequences gi|449671095|ref|XP_002156913.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]