SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449671307|ref|XP_002164113.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449671307|ref|XP_002164113.2|
Domain Number 1 Region: 305-556
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-46
Family YWTD domain 0.0000171
Further Details:      
 
Domain Number 2 Region: 18-232
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-25
Family YWTD domain 0.0002
Further Details:      
 
Domain Number 3 Region: 610-864
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-19
Family YWTD domain 0.00058
Further Details:      
 
Domain Number 4 Region: 946-1092
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000149
Family YWTD domain 0.0018
Further Details:      
 
Domain Number 5 Region: 263-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 569-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000684
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 880-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449671307|ref|XP_002164113.2|
Sequence length 1442
Comment PREDICTED: low-density lipoprotein receptor-related protein 4-like [Hydra magnipapillata]
Sequence
MAWYGTLHVSLAETNDGVLFASNHEIFLYQVATQKIVTLADSLKDVVEVDIDYETQTLFY
VSESRRIISVNIITKEQKLYYAYDACLYVDNKLEVCSFDGLDRLVLYHKMSNHLKGLTVF
PSKGLLFLTDWGDNARIEKINMDGSDPQVFVNKNILVPNVIVADNDQVYWFDGQKLTLES
IRTDGSDRKTIFKAEENSFNSIVNMAIIDLRIYFSNLKKSSISSCNKFNGSVELCRTEIS
ELSEIKSIKSYGQKMQPFFNSGCHIRNGGCSHLCLLKPSGYSCKCRTGYKLLKDNRTCSN
AIEKFVLIATRPDLQIVSLDTNDFINIKLPISGLSTVSAVDFDPIDMRAYWTDALDNKYG
VIKRAFLNGSAVETIVPYGYTFPDHLAVDWIARNLYWTCPKFNKIYVTNLNGSASVVIVE
DNLDEPRGIVVDSEHGRFYWTDWGKTPKIEAADLDGENRVTLVNSNLHWPNGITLDYKKQ
YLYWVDGYRDIIEYYDLASKFRGVLKSSSPHMFGVSVLDDFVYWTDWTDRSLYKMDVSNE
VKVLVVNDIPDIMGVKAASITTTGNNTCHNNAGCSHFCFYKPSGNIRCGCPSGYELNMNK
KSCKPLEANLIYSTSTSISTISLEKSNSTGVIKVTGKDVSFIAVHLKSGTIIWIDKSGPS
SINGASLNHNSNPGIFQTGFYDLVEGLALDQISGNVYWSQQNKIEVSRLNGYFRKTIISA
NRHCCTSDKLCCFHTTLLALNSFIRKLYWIEETYDPSQHSALYESNLDGSKQRFLTNVTK
EVSGLAVDVNDSSIYWIEKNSHKILRLNTKDMLVTVIAYSLDSVTGLAIYLDRLYFCESD
SETLGKISSVKKVNGDIKLKFPIHGKCQNLAVLQANTPTGGNLCEFNNGGCEQLCFALSQ
SERICECETDFTISLIDNTSCIGPQTFILISEKTLFYRVVFSKMTEVPIYFNFPTYISSI
EYNVNSQTLYWLDEMKHQIFFSQNGVKKKVNLQVENAFPISFVIDLFSNCLYWIDELQKI
GDISDGLPRYDVAVDHKENRVYWLDKNKATVQSINIKGQSLRTQFKFNSEKFSPVAISVF
DKYLYWLDQDTNQHDTKLKRALLDTEVSKEIKVLQRSYKKVNDLLIVDVFRWKANKEVLT
KKNSLSKKQIFTHKEVESYIFDESEELNEVSEEDCSLSDVFDGENSEPELLELGLEDETP
ALLNALSSSESSLENEFSYIPKWTSEPPVRRVQPFAFTGVSGYNQNIVKNDPLYLFELYF
TDEICEFIVNETNQFASQIINKKELSANSRIRRWLPVTVPEIWQYIAIFLYQGVLWKPIY
EIYYTTNPLFSSADESLLLWKGRLFWKQCIRSKSARFGIKTFSLCESDSGYVWKSVLYTG
SELTNTLSSEYRYVGTKIVMFLMGGLLDQGYKLYIDNWYSSYELSSVLLLRSTDTIGTIR
KD
Download sequence
Identical sequences gi|449671307|ref|XP_002164113.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]