SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449672001|ref|XP_004207610.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449672001|ref|XP_004207610.1|
Domain Number 1 Region: 87-291
Classification Level Classification E-value
Superfamily vWA-like 4.82e-40
Family Integrin A (or I) domain 0.0000786
Further Details:      
 
Domain Number 2 Region: 310-377
Classification Level Classification E-value
Superfamily Integrin domains 0.000000115
Family Integrin domains 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|449672001|ref|XP_004207610.1|
Domain Number - Region: 51-106
Classification Level Classification E-value
Superfamily Integrin domains 0.00785
Family Integrin domains 0.0074
Further Details:      
 
Domain Number - Region: 387-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family Integrin beta EGF-like domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449672001|ref|XP_004207610.1|
Sequence length 675
Comment PREDICTED: integrin beta-1-like [Hydra magnipapillata]
Sequence
MVKAVSVSLLLSYSQDFLQLNPSKYRCDTLSNLTQSGCKNITIVNSDFQITKNDDLQDLV
QVKPQEIAVQLRPGQPVKVKISIKPAPDYPVDLYLLMDVSNSMADDLLILKNLGVVLAYI
DIHLPAFDTDNSVAAQNISGTLNVPQGLFDALMQTTVCEQELNWRDKNTCRKIIVIVTDA
APKVGGDGKIGGIWKVNDAKCHMTKAASSSQSILLEYSAYDIYDYPSVFQLNQKLKEYQV
VPIIAVTSDVMSQYQDIANVWKDLGTVIAELKSDSSNIVELIKNNYNLISSTVRLSDNSP
DNFIISYEVNSTQCPSGSGNLCPNVSLQQQVDFFVSITAKTCPTDLANAPNMLAINIAGF
GVVNVKVQYLCNCPCAAFAVQSSPKCSNGHGTFECGVCKCDSGYYGSICQCDSSSSQFNG
TSNCQADPNNNSSLCSGYGSCDTRGACVCGQCVCNKGFLGSNCGSIDCNYNLQTKCTVDG
VVCSGNGNCDCQQGGCNCNTGYSGTHCETCVTCPEICNNQTRQNCILCNNFKDEISYNKI
DVNCTNCNLYPMINVTNAQQCSITLNSTCKIFYSITYQISNQLSSEITQVQTALSCAAAL
VANKDILPIVLGIVGGILLLGILLLLIWKLLVTLHDKKEFEKYTTGQIKSNWEEAENPIY
QQAKQEFQNPVFAGN
Download sequence
Identical sequences gi|449672001|ref|XP_004207610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]