SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449673375|ref|XP_004207940.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449673375|ref|XP_004207940.1|
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000000314
Family Kelch motif 0.021
Further Details:      
 
Domain Number 2 Region: 678-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 556-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000599
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 631-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Laminin-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449673375|ref|XP_004207940.1|
Sequence length 730
Comment PREDICTED: multiple epidermal growth factor-like domains protein 8-like, partial [Hydra magnipapillata]
Sequence
AKSGVSNDMFAFNIKLEKWSIWLLPESSSPALAFHSAVISDNHLILHGGWIFNADRNEPE
PSNATYFYNLMCLLWVSYPLKSNGYSLKKRYGHTALMMDMQTVIIVGGFNGAFLLNDVLV
LKIPFQITGLQYKCLSDPSCIYCSSCVPYYQKNICSDPILKPYLCQDQCSFLSTCEECTA
YTQCNWCTLTSFCQSKENKNCFQEQKLWWGSNNGILINATDECQLLDEPPGITYMYYLKP
ENFNYPDYVKVLPHGKSIIYNVTSKATLILKGAIYPFFRFFNADFTNHKVLLRGRNLNAT
LSLSSINGVSNLVEVVSLPFDDQYHEVVTVKNPIFLYNKVDRFQTQNLKYTIELKANLIN
LGSDQYAAIEIQWNHTDNEFFALYPIPGSYLQPFKTTNCSQYFSCSGCVSDMFCGWCDTV
LSCMPRSSWSLCFNISAGYLVRNQSQCMMCKHNFDCESCKKDFFCDWDEDLLKCTRKELV
HASSNCSSCNKYMLQNCSTITNCSSCLNAFHCGWCYDFIDPRVGRCTIGDFSGPIKKCQI
VTIKSEPAWSYEVCPDINECALNIFSCDINAYCVNTMYSYECKCKQGYIGDGKSKCIKTC
WPECYQGVCNETTYKCECNLGWTGQNCSVDCGCNGHSTCLYGVGICDQCQENTVGKYCEK
CINGSYGNALTSTGCKKCECNGHGNPLQNYCHSANGECFCLHNTIGSSCELCEPGFVGNP
RNKILIVYVK
Download sequence
Identical sequences gi|449673375|ref|XP_004207940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]