SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449674823|ref|XP_002158143.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449674823|ref|XP_002158143.2|
Domain Number 1 Region: 178-440
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-20
Family YWTD domain 0.00019
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000209
Family YWTD domain 0.0017
Further Details:      
 
Domain Number 3 Region: 517-652
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000262
Family YWTD domain 0.0056
Further Details:      
 
Domain Number 4 Region: 745-782
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 440-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 705-741
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 7 Region: 130-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  gi|449674823|ref|XP_002158143.2|
Domain Number - Region: 784-808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00694
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449674823|ref|XP_002158143.2|
Sequence length 808
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like, partial [Hydra magnipapillata]
Sequence
MTNHIYWSVRGNYTRIECADLDGGNRIDIVWENLLFVNGIVFYKNILYWTDDGVTEIGMY
DTIKKQRFKLSAEVQQLFAISALDNYLYLTDFLRKVTRFNIATKELRTLISGDSMADVMS
IKAVDTQLLTGYNPCHYQYTKCSHLCFFNVMKNASVCACPAEMELSLDTVTCIVPNGFLL
YSGSIDGLKKLSINTNRASKLSLPNSKSARLLEIYSNESRIFWSEETDPYYTINSAYLNG
SGFKTVVSGGLKNVNGLAIDWMAQNIYWINGRIEVARLNGLFRKVLIYGEDILELTLIVI
NPVVSRMYWFQRSLNGSDQYSLWQANLDGSSRHLLIKGIHPTSCSIDYKTNNIYWVHQKL
QDSSIEFYDFKSFKRVLVHSGLPPTYALLVFQDSLIFGSHGDSTSIKKLSVMGKGQVIDL
IKDTPFIHDIKVVHNGLQLGSNLCSRNNGGCEHLCFALSVTSRVCSCATHYNLVEDGRCF
QPEHFLIFSYEFSFARVIFQDSVPEAVLPIYSQVKSSAIAFDEVRNFLYWLDSSTTSVSR
VHQNGSGYESIMLSYSESSILPDPYDFALDQFNTDSIHSISLSGKDFIDNIVQNIHTPVA
LAVFGQYLFYADSSRSFIYKVSKENITTQTVFHGKYEHLSSLVVVNLTRGKDSHPCRINN
GGCSDICTINYQIDHSPLKSSPMPLCACPLFQSLVNGSTCEVHEHCNSVNEFFCKSDSLC
INSSKKCDYKEDCTNGEDELCSYPYQPCNTGFIACGSKGCIDVSKRCNGKVNCPHGEDEY
NCDLCGQNQFHCKDDYRRCINDFQICDG
Download sequence
Identical sequences gi|449674823|ref|XP_002158143.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]