SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449674861|ref|XP_004208275.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449674861|ref|XP_004208275.1|
Domain Number 1 Region: 2547-2671
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.12e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 656-776
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.59e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 1338-1470
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 2205-2272
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-16
Family TB module/8-cys domain 0.00059
Further Details:      
 
Domain Number 5 Region: 2360-2485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-16
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 6 Region: 877-1022
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 7 Region: 1115-1182
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000458
Family TB module/8-cys domain 0.00036
Further Details:      
 
Domain Number 8 Region: 2098-2215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 816-890
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000301
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 10 Region: 1468-1597
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000847
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 11 Region: 125-208
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000628
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 12 Region: 569-697
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000107
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 13 Region: 2007-2125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000565
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 14 Region: 1793-1851,1914-1934
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000432
Family TB module/8-cys domain 0.0024
Further Details:      
 
Domain Number 15 Region: 122-274
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000534
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 16 Region: 1188-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000258
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 17 Region: 2483-2566
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000497
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 18 Region: 770-817
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 19 Region: 1261-1348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000129
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 20 Region: 1075-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 21 Region: 1632-1707
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000942
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 22 Region: 2275-2312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 23 Region: 1958-2005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000193
Family EGF-type module 0.014
Further Details:      
 
Domain Number 24 Region: 278-332
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000379
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 25 Region: 1012-1067
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000589
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 26 Region: 1586-1636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 27 Region: 1751-1800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.014
Further Details:      
 
Domain Number 28 Region: 2726-2836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000151
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 29 Region: 2662-2710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000222
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 30 Region: 2312-2351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family EGF-type module 0.006
Further Details:      
 
Domain Number 31 Region: 400-446
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000693
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 32 Region: 451-501
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000144
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 33 Region: 358-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000222
Family EGF-like domain of nidogen-1 0.091
Further Details:      
 
Domain Number 34 Region: 95-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000637
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  gi|449674861|ref|XP_004208275.1|
Domain Number - Region: 1714-1765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000983
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 60-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00269
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1232-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0148
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449674861|ref|XP_004208275.1|
Sequence length 3072
Comment PREDICTED: fibrillin-2-like, partial [Hydra magnipapillata]
Sequence
PNKCFGGFECCPGWSLNPSTRLCTVPTCRNPCGFGICRSPNLCQCLTGGFGSVCNNAEND
LNECQGRCMNGGKCENEKCLCKPGYVGLSCEQPICEQPCLNNGRCIGPSRCACPYGFTGL
RCEEDYRVGPCFTRVEDNMCKGQLVAVKCTQESCCATVGVAWGVPCSKCPEKRDCKKGFY
KDPRTGKCSDINECRGIPNICAMGTCVNTDGSYHCECGTGRTYNPDKFECSDVDECSLSS
SLCEFGKCINIDGSFKCLCNPGYKAVFHGKRCVSDETETPPNQCFSKFNNGQCSSLLFNQ
TTKKECCCGNPERAFGLCNICPSKGQEEYRALGCPDDEIGTGGDGHNEISYGEGNDVCES
NKKICEFGRCEKYLNSFRCVCNVGYIAVNNGKRCQVVDAFDTCYLEFNNGKCGIPSPEQS
SKRECCCSNRNHAFGFCNQCPEKGTALEKYAVCYKNFDDGKCTIPSKREVSKRQCCCGNP
GRAFEFCQQCPAKGDDSYKELSCSDDNIFDIDSVDVKLPEDKKGNTGETINNNIGFASTN
NSIPTKNSNNGIDSKDVDDNLVGTGEDGDVQCDDMFLSSCNNGRCEKMNGKFKCFCKVGY
EKNRNNYCADLNECKKYDGLCHGGACENTPGSFKCRCPEGHVQSPDGFACMDVDECENSS
SCINGVCKNFPGTFQCRCNQGFESGLTENICVDRNECLTPGICPGDSKCLNTNGSYICQC
KEGYYAQSDTTCVDIDECRIIKDLCIGGRCVNTDGSYKCICPPGYELSQDGKSCKDYDEC
KNMPDICYGGECINGPGSYRCSCNFGFRVTESGTSCIETRSDKCYASFNGLQCSKPLLTE
LTRVKCCCGMENTGIRAWGAGCESCPKRGSSRYEKLCIHGPGLDDTGKDIDECNINAGLS
TGICEHGSCVNLFKDYQCICEKGFTNISNKACQDIDECLEAGVCEGGKCTNTLGSFICEC
PKGYQFIKESRICKDEDECLTNPCVGGKCINTGGSFYCECPPGSFYDEKRKFCKDNREGN
CYTYNEIERKCEKKIASFLSKSECCNGLGSAWGSDCEKCDSDSSYGCKKGYKRVGAQCID
INECKFSSACQNGRCINTDGSFQCICPTGYKLEGNSCEDIRTGICYRNILNNQCGMALGD
LKFKKSNCCCSAFARAWGNPCEVCPIKNTLEHKELCPSGEGFNEVGEDLNECSIPDICQN
GKCINNHGSYRCLCNSGFDVDATGSICVDVNECVISKTICGPGKCVNTIGSFRCSCYEDI
NECLEGNPSPCQSGKCINTPGSFKCECPSGLRTSETSSSCEDINECEQPGVCQNGICQNF
IGGYHCSCLTGFVSSSDMLQCHDVDECSNNNGGCEYLCSNTPGSFHCGCQPGFELLSDKK
TCADINECERGTPCGEVNTCTNIVGGHVCTCISGYRASTDGKSCMDIDECTEIENICQNG
NCFNIMGSFLCNCKDGYKLDINAMSCIDIDECLLRENGGCHLDAGCINSVGSYSCRCKTG
YDGDGFNCTDKNECDLDIASCAQDAKCVNTIGSFSCECKEGFKGDGEVCLDVNECEGNKS
LCNPGKCINTIGAYRCECSVGYQPTEDKRHCEDINECDLKNVCLNGICKNMLGMYKCICE
EDKGFTPNKNETACLDMRLGYCYNKHLTPCGNSKLSSNKMGKQFCCCSAPDGTTWQNDND
EACEICPYIGSDEYKVLCPGGPSSHVNETTGLVENHDGCTFLTNYCTGGQCSNNLDQGIS
CQCPEFTQFNDKNLICEDINECLTAGICGFNAKCVNLEKGYRCECEKGTVFDEENNFCHD
FRNTTCFLPNKNFNNECKSPLPVQVSIGQCCCGVSGNRYGPDCKACPMSGTEREALCVKK
PTIGPFVTGQPPIGSTKPTTSLKPIKRNPGVLPTISSIGDISGTSQPNVTVNIKYDIDEC
KFYPDICGEGTCVNSIGAFHCNCNKGFKEEKVNSINKCVDINECLTNPCVNGICNNINGG
FFCSCKEGMTLDKTNLNCVDLDECKTPGYCENGKCVNLLAGEGFICECGNGFRKSLDNKT
CTDIDECSLPGICIHGKCKNIPGSYNCDCDQGFKTNLAKECADIDECNDYPDLCIHGHCI
NLFGSFMCECDDGFKQDPIKQSCPDINECQLPGYCENGRCKNTVGSASCECNQGFEKNIN
GTSCEDINECSDADNTCQIGGKCVNVVGTFRCLCNAGFISDTDNRQCIDMRKGFCYSLVQ
NKQCMFSNEFSISKSTCCCAMGAGWGENCETCPDKGTKEFEYYCPNGVGLERNSTDINEC
ESNLGKCMNGKCVNTDGSFRCDCNKGYILSTSDPTKCEDRDECTDGSSPCGAGTCRNLVG
SYACECEKGFRSHSLSDPSCVDINECDENNGTCSYQCVNVPGSYTCVCPNGYTLSDDKKD
CQDINECLIPNICPHRCENYIGGYHCLCLEGYNMDRLGRCVEINECLQDKSLCRPGGVCQ
NIEGSYRCDCIPPFMRSYDGKHCEDKSMGLCFSITDEKCQASTKMNKVSQRECCCIGGGF
SWGSDCRRCPNSNTAAGKSLCNGNKNKTINECEFIVGVCSNGKCMDLAEGYRCICNSGFK
LSSDGKNCRDIDECKEGISQCKGDCVNTEGSYKCVCPNGFKVDSDQITCVDEDECATSKH
SCQHKCENTEGGYKCVCNAGYTMEGNNCVDIDECKETGICGLATCKNTAGGFDCVCNRGL
KYDADKKLCAYVADTTPEVINPQGCGQPACGCPYGYYPYYSPNGAMQCVDINECKQNMCG
TSTCLNKLGSYSCLCPAGSTFQGGRCQDENECSGQSPCSFGCSNNRGGFACQCPPGYTPV
SGGHCIATHGAVCFTCDTSEIPSEGVPLGNLEQDSSSGYQAAVGKGYAPLTGSSYPNFAS
LDRGYSPVGEVPTDSQYFSRHQQKIAPYPKPIDSNLRVNSKQLSSKVLSTRLNPYQQAYQ
TGRHSIKLQEQVNFGTSQTKQQFSDRSYRSRRSTHELTKPIDITISHKTPPRSPIMNIVS
VLKAMEEHYEIKSGNSSLFTLAPDLNGGVFLNITTVLNPGIYRLAISTEYKNVEEEHKEQ
AKSLMRVRVKVL
Download sequence
Identical sequences gi|449674861|ref|XP_004208275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]