SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449675022|ref|XP_002159625.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449675022|ref|XP_002159625.2|
Domain Number 1 Region: 198-338
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.25e-31
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 27-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.72e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00095
Further Details:      
 
Domain Number 3 Region: 478-660
Classification Level Classification E-value
Superfamily Fibronectin type III 4.17e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 344-423
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000207
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449675022|ref|XP_002159625.2|
Sequence length 756
Comment PREDICTED: uncharacterized protein LOC100210872 [Hydra magnipapillata]
Sequence
MILQKNKWLQFCLIIYLECQSVFGFLCDNSLGLNRGLPDNVKLPDDRFSASTNDGLHLPK
YGRLYSEDNNNSVSTKRDQVWCASKDDSAPWFQVDLGFVQAVAKILIGSHESVASFVKTY
AVKYSYNGTLWFDVLENQKTKIFNGPDSYYDYLNETLVKPLITRFVRIYPNAKEGVSFCM
QVELYGCIPKKVHSKNVGLENSTIFSNERFLASSVYKNTNPFEARLTHSSQLAAWCADVN
DKTPWLEIDLMYIRELSEIETQGFNQTNAWIKSFRLNYSMNGKNWKEYNNYQTFVANSNS
NEIKMIKLDPFLTRFIRILPVIWKDLPCLRVNLKECETPTELTPKLIAGLTDETVNRGEP
FDLKCEFNGQPGITIAWNMNGKFLPTNNRFSTSYVEFRGNLNAKLSFDRIKGQENGLTFT
CLACQQLCKCLSPGSEPRGILNDFKWLAYLSLKGVSLIPMIYVNIVFSVFILAPSPLLNV
TKIGSSYIMVLFSFVGNLTKDTVGYVLNVSSSNKLSRHQIDSKDEFNISDSIKPYKNYTL
AVAIAYLENEVGDYFSVTVETQQDRPYGPPLNLYVVKIQHDALSCSWSMPEEGLRNGIIT
HYMIKYKKSVKLNEEPNIIQKIVNKTHIDLYNLEAGVNYEISVQAYTVVGGGPFTHPPFL
IFTGEATEELTELNKVLITPLNAAGIGKRLQNITADPDFLNKHDITLTLDILEKIVRVEN
GSRLIGEALVTAVSNVLKANKTVLDESEISNKTGTR
Download sequence
Identical sequences gi|449675022|ref|XP_002159625.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]