SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449675077|ref|XP_004208324.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449675077|ref|XP_004208324.1|
Domain Number 1 Region: 717-844
Classification Level Classification E-value
Superfamily Ctag/Cox11 3.01e-51
Family Ctag/Cox11 0.0000339
Further Details:      
 
Weak hits

Sequence:  gi|449675077|ref|XP_004208324.1|
Domain Number - Region: 300-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 347-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 255-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.041
Family Laminin-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449675077|ref|XP_004208324.1|
Sequence length 855
Comment PREDICTED: multiple epidermal growth factor-like domains protein 10-like [Hydra magnipapillata]
Sequence
MKEKRDVICYDGFFGDRCDQVCVNSTFGPNCTKKCNCKNNATCSPIDGTCSCTEGWTGTD
CSIECDNGFYGIDCSQNCSCSIHGKCNRFSGECQCFGEYQGKTCETKCGNWTFGRGCNNT
CICLQNNSVRCHGMTGECTCGDDWLLPDCSEKQECVSGRFGDKCLSSCSCADRSVCHHIT
GKCNCTEGWQGDICNTMCSQGRYGLNCSKICNCSNGGECHHISGSCHCVQPGWKGERCSE
VCDQWKHGLDCQEDCSCFPSNTQSCDPKSGTCTCKSGFMPPYCTSICTTGTWGFNCSQPC
ECNGSNSENTTCDPETGQCECLAGYKGRQCNQICEGNVFGKKCLYQCVCNFTGMSGLCDR
ASGRCFCSSGFMGIICNETCADGFYGSNCSTECTKCRICDKQTGYCAVSNPIYDLTSKSS
SRDDKSFKVENESDDYSVLFKNKKHKKVSIEHPDLSFRKSDQGINVNENLLYDELNQTNE
EMNQSYDVLEHDKHKRKSQIDNLEIKNNSYDVLSKKSSNLYTSSPIMQKDFSTNVESKDF
STNVDPDHLYTSTASMQRDSTKNDFNVTSNINYYAVSNCVNVNSIYGDASGDCISTTKKG
KSTAKEDERFSDGDKKCGFNNPILINGELTNHIKIEDSIIIIAAQGLLRNTFFFSVKRFF
NSGGGKVSGKQTTLLYLSALVIITAGLSYAAVPLYRIYCQASGYGGSVKHADTGEQIENM
KRVADRKLIIRFEASTGNQLQWSFKPQQKEVQLTPGETALAFYTAKNLSDRPIIGIATYN
VVPFSAGQYFNKIQCFCFEEQQLNPREEVDMPVFFYIDPEIDEDPLMEKVKEIILSYTFF
ESTGNISLPSPHHTR
Download sequence
Identical sequences gi|449675077|ref|XP_004208324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]