SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676197|ref|XP_002162576.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676197|ref|XP_002162576.2|
Domain Number 1 Region: 614-753
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.81e-34
Family Fucose binding lectin 0.00058
Further Details:      
 
Domain Number 2 Region: 933-1012
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000133
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 3 Region: 762-881
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 889-934
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 5 Region: 364-434
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000001
Family Ricin B-like 0.026
Further Details:      
 
Domain Number 6 Region: 995-1060
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000131
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 7 Region: 1326-1435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000181
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1445-1489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000254
Family C1 set domains (antibody constant domain-like) 0.068
Further Details:      
 
Weak hits

Sequence:  gi|449676197|ref|XP_002162576.2|
Domain Number - Region: 463-562
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000477
Family Ricin B-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676197|ref|XP_002162576.2|
Sequence length 1524
Comment PREDICTED: uncharacterized protein LOC100210038 [Hydra magnipapillata]
Sequence
MPDEVSYDGIESFENTDISFDTVSIYFEGFVNILGIKASAFLNVSTTELEMYIYGKVLNL
IYAELYVATAYDYLKITEMHFYIRAIVDLRGLTDAIERARKAVNDAFIYAQKKLLSAVED
VKAAKIKCKEKLKIDCANCYALKCREAQNNCKNFLDSAGKWIGGQFNKFGQWVASTARKI
GDGMANIGRKIASFFGRRRRSSLLAQRDEQFDIHIRNKRFVSKILCEGLVGGGCKAVSHL
CHGTCSAVDFIGQGLCNVLDVATAALKATEVAMGWVNSAIQFVMQMFLVHGIRFELGLGQ
KLNGFMVGAAIDLTIFGQRQYFEFQFDLKNPVQSIMNAKDGGLYRYKEGTFGIESLRTRS
ESRLGACIAAPTTDVNEEMVLIACNNTDERQRWTHTLHGMLINLYSKKCLALPDMVDGKL
FQSDCDSQKHKHLMNIECDLKTKTLKLRKKDLCVTTVITSEIGPGSIQHHGSLKCIHISP
GNKLVLRNGCQQTSTEFEMNQNGHLYFRFNGWCVRVSNGIAISGASLELIQPSLGCDSFS
FTKQGSLQHISSRLCVQTLQMNDLTDKMFELPKEICWGQKNENNKLFMMECGELWNMKFE
QRFGIMHDEINTVCSKHWPDLALNKIAVQSSTNRNGFADRAVDGDFNFQWEKGSCTLTNE
EVDPWWRVDLGNEYIVTDVTIVNRGDRGDYLTNFQVHVGSNLVVRQNPVCHDIVRYAGDA
EAIRLQCNPPIPGKYVGLQMFGTGVLSVCEVIVASRLGSLSDYCQIENGGCDQICHNECG
SRKTTCSCRPGFKLAYDGKSCFDIDECLINNGGCRTDQHAYCKNTPGSFHCLCFKGFIHK
DNSLTECTDINECGSGNGGCEQMCNNTLGGYLCTCRKGYERKKNDMYGCQNINECLINNG
GCEHNCNDFDGGHYCYCRPGFNLMEDGVSCEEVTCSTLEVPQWGIVSPSICTKRFENLFV
GTVCSFQCAKGYEIKHDLNATSLLCRTDGTWNSSMPSCYPEKCPSLVRPENGGLIPSRCH
SSGNGYNEFGQRCVAYCDHGYQLQGPATKYCLSGSAWSSEDVVKCIKVIDIPYLNCPNDF
SLTLPPDKNTVSLGSDWVEPNTNINFTRISVQPVGVGRSYQFRAGQTVVSYSSMHDSGSL
FSCSYVVHVKDISPPVLLSCPSDIVIVSSSPRETISWTPPTFTDNVGVTDIILPRWKPGN
VWESGEYRKLHYDAYDAAGNKQTCSFTVTFKSLDCPTLYGDNSTVITTFVPQKRYSIVCL
HQKTLFGNFGYDGSIVYCKDGDYWIDSVKIGLSIPECVSYTKSSLNQICDVGSEKLLYEN
FFGETIYYCAVCPRGSAYNSSSKKCELCPVGSYQDQYGKVECETCPRGSTTKQIGARFEK
ECLTQCKPGYYSSSGIDEDNESCVACSVGSFSDIYGATSCQVCPDGGVTLMSGANDKNLC
TKPIKITQVLPGLTVASSEGSSITLKCYYEGYPLPAVFWSKSSGKFLHLPPFLLDDDDNG
KCDYYYVNHNYEHHASYSNVFCLL
Download sequence
Identical sequences gi|449676197|ref|XP_002162576.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]