SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676266|ref|XP_002155546.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676266|ref|XP_002155546.2|
Domain Number 1 Region: 357-515
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000806
Family Paired domain 0.054
Further Details:      
 
Domain Number 3 Region: 505-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 676-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family EGF-type module 0.041
Further Details:      
 
Domain Number 5 Region: 644-687
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000452
Family EGF-type module 0.045
Further Details:      
 
Weak hits

Sequence:  gi|449676266|ref|XP_002155546.2|
Domain Number - Region: 331-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0231
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676266|ref|XP_002155546.2|
Sequence length 917
Comment PREDICTED: uncharacterized protein LOC100209707 [Hydra magnipapillata]
Sequence
MGKKAVDDTTRWQIVALKQNKDKSDTQIAKELGVSRKCVSTTIKNYKSRKSVKDMLRSAR
PENLSTRDKNFFIQKVNAEPKITPQELAEDFNSSFRNHSVSYETVRKVLKEKGIISYIAA
RKPLLTVRDWLRRVKWCREHASWSVEDWAKCIFSDESNFEVIKRKERVYVKRKKWQKYDT
RMVSPRIQGGGGLAGVWGCISHKGPSPSDVSSKSFTISIPTFTTSELIALFWIIIRSQDN
LSLPKKAPNQYTDKEINENVDGWFRLGPISNNSKSFTVRSSKSNRKRRSTDGFVFTEGQV
YVTFVQALTASNKVLSSPYYPPVITADPGSPCTDLSCFAYKHQICSMVNLTFAKCYCKNG
YISFDNLLTCQDIDECLSENSCNFKNSQCNNNPGFYTCSCVNGYDLSNDEKSCIDVNECQ
KRCKAPNQTCINTIGSFECRCNISGSFYNATSDICQDMDECSTGNTPCDPVRGICINENV
LQTGKRYTCSCPSGWKLLNDGSNSCVDVNECLTLCNGTNASCMNTIGSFKCSCDVGFSLN
SSYQCERNVCDACPTNSNCSVNSFGYVGCTCNLGYSINYISQCEANQCQSKAMSCLAPHQ
VCQNDNSGLGFSCVCSNGYTKVGNDCIATNTSICKYASSQNITLCPSNQQCVDVNGSFEC
GCLAGYLKNASGQCEDKNECLIENICMENAECVNSNGGYDCRCKPDYSGNNETSPSTKVC
YANSAWSSWEQVGQCSQLCQTDQNIGKLSFTRVCLSSGKYCSGDEKKEEFCNTEYCDNKI
KVSKSLECLKWENAEGSINLPFKEDNQTWFLELRKWISFYIKASKCFSIPNIKASIQSEL
IELELETAKLKTVRLTLRQVIHCNSYLQKINDLYQKYRSIQSRLVTYTTIKTAFKKLQAR
LALKQNECIDCKSIFLF
Download sequence
Identical sequences gi|449676266|ref|XP_002155546.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]