SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676276|ref|XP_002163241.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676276|ref|XP_002163241.2|
Domain Number 1 Region: 120-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.76e-38
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 359-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000457
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 3 Region: 571-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000786
Family EGF-type module 0.024
Further Details:      
 
Domain Number 4 Region: 54-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000635
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  gi|449676276|ref|XP_002163241.2|
Domain Number - Region: 671-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000159
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 531-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000296
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449676276|ref|XP_002163241.2|
Sequence length 716
Comment PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like, partial [Hydra magnipapillata]
Sequence
MCSVDSLNSETKSNTVFSTNVVFRGVHINQKLLCTCQTGYRDGPNAPNSCSQKFSLCYAK
PCGPYGKCISTDEGFTCICDVGYSGKYCNVNKITSKCPGTSPFALDSNPCGTNGQCVNED
KNGFRCQCHSKIENEFCTYSTAHFQKESYIALNGLKQRWNLTLSLEFATHDSDALILYNG
RYSNSNDFIAIEIVNGQVVLRISKGSLKNEKEKVTTVESFIAGGVNNGEWHFVSVLYQDK
VISLAVGHSCDVNIAHLINPEGLMKHCSASKIVDGEMKSLDLTAPLLVGGYPFQSQFIRT
SSKSFVGCIRDITIDYKKFDFSSAIQTYNIFPNCPKKEFCSKANPCIHGRCIDGLYKAIC
ECKVGFIGEFCDQEIISSSVVSLKSTSELVMGQIKSTGTHPTAIMLKTTHLSGTIWEEEI
NFKKAVLKISDGYPCYIFDSKLKLNLSDIFISDGKWHQLEVSWESTRLVLSADYKKFRRE
YLLYQSSSSQKMIAVGGQDKEKFVGCLFGFQFGGNYISLENVQNKNIESGCDDSDVCSSF
QCGVHGSCKTYYSQPQCHCERGYQGPRCEDICLSKPCLNSGVCAQSMISKSGFKCICPGN
FTGDLCETEIKSTCDDEYYGDPKSGLCGPCECKAHENFDNKCDKDGQKSGIPGKCFCKDT
FYSLNGKCVPCDCLLEGSLTPTCNKLTGNCICKEKVSGQKCDRCPGVWQELRSKCN
Download sequence
Identical sequences gi|449676276|ref|XP_002163241.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]