SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676278|ref|XP_004208594.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676278|ref|XP_004208594.1|
Domain Number 1 Region: 242-376
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-34
Family Cadherin 0.0021
Further Details:      
 
Domain Number 2 Region: 633-765
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-31
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 529-639
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-27
Family Cadherin 0.00088
Further Details:      
 
Domain Number 4 Region: 350-455
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 139-246
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 744-850
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 42-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000654
Family Cadherin 0.0092
Further Details:      
 
Domain Number 8 Region: 458-519
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000143
Family Cadherin 0.0039
Further Details:      
 
Domain Number 9 Region: 843-909
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000209
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676278|ref|XP_004208594.1|
Sequence length 919
Comment PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like [Hydra magnipapillata]
Sequence
MDPNYSTYRAEHGSGSPGIWVCINYEGVGPVLIRKRRSSDIYFEHDQYTIEVKENIVVGE
TILKLNVYGGSGKYIFKKSNDLKTDSLFKVDENSGEIKILNKLDREEGATLFALDITASD
KDNLNLIAYTTVKISILDINDNHPIFSMPAYLKTIKEEQPLNQFILTVQASDNDFGINSE
IKYSIIKNTSIDIPFEIDEKTGVIKNVQILDREIKSFYLLYVKAEDKGVDPGSLFATVLV
NITLEDINDNKPTFSKSKFVITLPEDTPVNQVILNVTATDADSGLNGKIEYRRLSQSEFS
IDSSSGEIKLVEPLDYDRSNKLYEFVVDAFDCGFPPQHASVMVEVIVEDVNDNSPIFTRR
SYKTSISESSEIGTIVFNKLTAKDDDSGENGRVTYSFLSDTPKDLPFLLDPLTGALKVLN
KLDYEVKKSYTFFVVASDHGVPQRSDQVSVTIDVENINDNSPHFKNSSYIISISEDAIRG
TPLLQVQAEDLDYLSSENFEYSIVDGAHCFQIDAFSGEDQQPGFANLTINIYDANNNYPR
FAESIVTLMVAEDVPIGTIIGKITATDDDSGDNAKISYFLQNPDENFLLNKDTGELYTQL
NLDREKKLSYQLIIEAVDHGKPVSLSSTTTVIIRLIDVNDNAPKFVKDNYDVEILESVAI
GSFVTTVSAIDDDDGINKLISYSIESSGDDSFAIASDTGIITTIKLLDREVIPAYKITVV
ATDKGIKQLSTSILVNIILKDVQDSSPVFEKSIYYFSINENSTTKTVGKVTATLADKDFQ
NSLIYSISKNIQNYFNIVRRTGVIEVSRSLDYEIQSIYILEVRASAPSGKEDKCVVNVTV
LDINDHPPVLNDFYIFLNNNSDSDNLAFKVPATDVDVTSKLTYSILRGNEMGFVKLSENT
GELLLQKSIMNTVLKYRSF
Download sequence
Identical sequences gi|449676278|ref|XP_004208594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]