SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676282|ref|XP_002155196.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676282|ref|XP_002155196.2|
Domain Number 1 Region: 138-468
Classification Level Classification E-value
Superfamily Subtilisin-like 7.07e-88
Family Subtilases 0.00000000179
Further Details:      
 
Domain Number 2 Region: 468-613
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.64e-40
Family Proprotein convertase P-domain 0.00012
Further Details:      
 
Domain Number 3 Region: 42-115
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 4.08e-16
Family Prohormone convertase 1 pro-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449676282|ref|XP_002155196.2|
Sequence length 863
Comment PREDICTED: neuroendocrine convertase 1-like [Hydra magnipapillata]
Sequence
MNLYHVTLKRNFILFSCSIVILFSFCCANDEDGSDIDPGKYYTNGWAIKLKGDDTFERAK
RIADKYGFDKVTKVGSLEGFYHLEHPHHPTRSKRSSESRTDTLLQDEEIFWAEQQHEYKR
ERRGLHHQHVVTRGIEPRFADPLWEEQWYLDDKRSQMDLDVNVIPVWKSGISGKGVVVTI
LDDGIEHNHTDLERNYDPAASWDVNDNDPDPFPRYDPTNENKHGTRCAGEVAAQANNSKC
GVGVAYNARIGGVRMLDGRVTDRVEAESLSLNPQYIDIYSASWGPSDDGMTVEGPGTLAS
AAFLNGITKGRGGLGSIYIWASGNGGRHDDSCNCDGYTASIYTLSISSSSDHGESPWYSE
ACASTLATTLSSGAHGEKRIVSXDLHNQCTERHTGTSASAPLAGGIIALALEQNPKLTWR
DVQHIVVHTANWIPLKRDPEWRMNGIGLHVNEKFGFGLLDADRIVQMANPETFKTVPTKK
ECKGKTFTDARSLRWDQPLVLEIESDGCQHLKEEIRYLEHVQLVLSIEYTRRGDLTIFVT
TPMGTRSVLLPVRSEDSSDEGFKRWAFMTTHAWGEDPRGIWTLEIKDGGESRTNTGMLRD
WQLVLHGTKEKPHHQNITHPEIPIHRKAIPDDVKNNGKSSVQITQITYTFGEQALPSQTI
LPPNEPFSQMFPNSLNLPIQQQQQFPSLSSNQNPIESLQNSISNDFNFNLNNNNFNPYSG
SSISAYANDANFNTNTNNYNNNNNANALSNLLSSQTLAQLSKVQQQLEHPLNSVTQLSNI
QAYQPGNNQFPVNMVGRSLGWSQSPNLQQLYPVPNANLWDFFGRMNSKRDIYGEDITSSA
KLRRKTSKKRNSLIEALEKMRNV
Download sequence
Identical sequences gi|449676282|ref|XP_002155196.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]