SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676408|ref|XP_002169515.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676408|ref|XP_002169515.2|
Domain Number 1 Region: 380-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000414
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 337-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000168
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 189-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 97-114,193-304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000132
Family Growth factor receptor domain 0.0082
Further Details:      
 
Weak hits

Sequence:  gi|449676408|ref|XP_002169515.2|
Domain Number - Region: 418-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000119
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 291-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000666
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449676408|ref|XP_002169515.2|
Sequence length 588
Comment PREDICTED: EGF-containing fibulin-like extracellular matrix protein 1-like [Hydra magnipapillata]
Sequence
MVVMAEAFLQNIERKALNKAIIHTSEPKTYKRYVDDCHARFASIKQQQMFLNILNEQHPA
IKYTVELENNLKQLNFLDINNKTKLPLNTDPCVYQLKCSCGSRYIGETKKKVISRCFEHQ
KNSLKEKWSSLGATGHSKTCHGKFDWLHPKTLSVAPEYRTRKIRESLEISKARVQQELRN
GDVVLNWDDDINECTSNVCPSGAQCKNTVGSFTCTCSNGYVMSDGACVPVIPQKCQNGFI
FKDGICQDNDECLSGSYWCPRDSYCFNEIGSYTCLQSCEQPFYQTIQDNICKDVNECLES
TFKCPKNYECRNKQGGYDCKLTKCDIGYKLFEGYCEDVDECSEEPGICGENGICRNAYGR
YFCDCQHGFHVDPFTQKCNDTNECLIDRAICEFQCKNTEGSYLCICPKGYEVRGNYCYDI
DECSTNPCPDASFCFNNFGSFACINQTCPNKFLSRVANKPGEIAACRKIEDCQGNKECDT
NQLHSVKRIAYKFYNRIPIRGFQFNYWTSFSRQFYSVKSEFIRGNDDEVFTIENVSNEKI
QIYNSKTVFGPKEIQLVMRTDVSARANNMLLWQYEYHMFFYVSEYDFH
Download sequence
Identical sequences gi|449676408|ref|XP_002169515.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]