SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676440|ref|XP_002166002.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676440|ref|XP_002166002.2|
Domain Number 1 Region: 421-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 345-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000146
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 3 Region: 46-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 4 Region: 120-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000272
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 82-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000346
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 235-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 7 Region: 272-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000577
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 308-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000979
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 10-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000139
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 10 Region: 198-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000245
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 382-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000681
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 163-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000225
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676440|ref|XP_002166002.2|
Sequence length 506
Comment PREDICTED: fibropellin-1-like [Hydra magnipapillata]
Sequence
MVFINRFLLGHCDGDPCMNGATCNEVRDGYECICPIGFKGTDCEEEDKCHPNPCHSGGVC
TESNGQYVCTCAEGFKGINCQEMNRCQPNPCRNGGSCNELIGDYECICPAEYLGKECTEI
NHCHLTPCLNGGTCSATLGIGFSGLVQCMCFPGFSGSRCEVKDRCHLNPCKNGGNCHDGI
CNCIGGYTGEYCETSPSPCSVSPCLNGGTCLTKGLTSYKCICRHGFRGSNCEEESRCEPN
PCLNYGICFDQEEGFKCECTHGFKGTHCEEELSPCDTNPCLNEATCIVEYQKYKCLCKLG
YKGQNCEDLDKCHRHPCKNGATCSSESDELRCECRQGFKGILCEEQDHCFPNPCLNGGIC
FENADSYTCQCPSAYKGIHCTERDPCHPNPCHHDALCMPEGEEFRCHCNLGWSGLSCEEE
DRCHPNPCLHGGVCVAHASLQYECHCPSSFAGLTCEVESASVHHYEDHNENLPNCRNTRF
GCCPDGENAANGANGAGCPEFHYRPP
Download sequence
Identical sequences XP_002166002.2.79663 gi|449676440|ref|XP_002166002.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]