SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676476|ref|XP_002167194.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676476|ref|XP_002167194.2|
Domain Number 1 Region: 1851-1868,1904-2077
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-29
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 1426-1543
Classification Level Classification E-value
Superfamily Cadherin-like 5e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 943-1052
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-23
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 456-542
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0036
Further Details:      
 
Domain Number 5 Region: 143-252
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 1236-1337
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-19
Family Cadherin 0.0033
Further Details:      
 
Domain Number 7 Region: 1142-1248
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-18
Family Cadherin 0.004
Further Details:      
 
Domain Number 8 Region: 1045-1140
Classification Level Classification E-value
Superfamily Cadherin-like 5.76e-17
Family Cadherin 0.003
Further Details:      
 
Domain Number 9 Region: 728-840
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-17
Family Cadherin 0.006
Further Details:      
 
Domain Number 10 Region: 837-949
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-16
Family Cadherin 0.0054
Further Details:      
 
Domain Number 11 Region: 250-374
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-16
Family Cadherin 0.0029
Further Details:      
 
Domain Number 12 Region: 632-740
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-16
Family Cadherin 0.0026
Further Details:      
 
Domain Number 13 Region: 1329-1430
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000007
Family Cadherin 0.0033
Further Details:      
 
Domain Number 14 Region: 530-640
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000249
Family Cadherin 0.012
Further Details:      
 
Domain Number 15 Region: 2159-2203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000644
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1608-1688
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000759
Family Cadherin 0.024
Further Details:      
 
Domain Number 17 Region: 2195-2235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 54-155
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.011
Further Details:      
 
Domain Number 19 Region: 1537-1602
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000628
Family Cadherin 0.0057
Further Details:      
 
Domain Number 20 Region: 2119-2162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000162
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 2237-2278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  gi|449676476|ref|XP_002167194.2|
Domain Number - Region: 2083-2114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000527
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 2273-2298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000904
Family EGF-type module 0.0094
Further Details:      
 
Domain Number - Region: 1865-1893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00185
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449676476|ref|XP_002167194.2|
Sequence length 2629
Comment PREDICTED: protocadherin Fat 3-like [Hydra magnipapillata]
Sequence
MFMMETSVIIVKDESFLTNQVVMRIEVEVSDGTFKGKTNVEIETVYYKPDKTFHFLDKVY
KVNVLENIKPFSVVKVINPVGYNRTEKLHYRILNTVPGFDIIKNVGVIITDNSSIFDYEN
VSFYILHIETAYNNIYARTYVNITIIDVNDNTPVFEQKKYFHPIDIETKKGTVLLKVQAN
DADSGENGKVRYSMLTKEEYFTCDSITGEISLLKGFIKSLTKPAYSLYIQASDNGTNILT
SKVLVEIPVLNEDQPKFMKIYEASINEDITQGSTIFTVVALAPQNRQVFYQIYAGDEFEL
FEIGLTTGELKLASSLDYEQTNSYKLQVKAIDSLSGSWALTDCEITLNDVNDNPPMFEKP
FYKVLIKENVAPAFLWVEVTVLIAFSHIIPYSDLLLILLIYLILLVYYTVGISNIVGISN
TIGISNTIGISTTVGISNTIGTSNTIGISNTIGTTATTVKAKDSDQGLNSMISYSFESNN
EVSHFFINSRTGDILTTQLLDAETKSEYLLKVTAADHGKPSKSTFVTVQINLADINDNKP
IFYAAKYNFFVEKFLHSNQFIGKVTASDPDINTKLSYGLSKTSSFIKIDSVTGILYLTGS
PLQMTTILLEVMASDGVHVAFTEVVIDCYARNDYRPLVLEHIDVAVMENTMKNVIIAEIN
PVDRDKGFYGKLSYQIDSQLAAKYFTINELGRIYSTDYSLDCELFQKILVPIRVTDGGGL
FSIIQVVVTVEDQNDNAPIFEYPSYRATVVTSQMTDESLLKVVASDPDKGSNSELFYVAQ
GLREGNVPIFINGSNGLISLSGIPKGLMYQFSVRVTDNGYPVQKSDTKIFIFVKGWNEEV
LKFDKNVYYVTVSENVPVKSHIITVNALLLGDNGRLIYTIVDGNLPYTNVSQFFKINPVT
GQVKIKSQLDYENIKRHKILVLVTSYKGDVSTCYIEVNVTNVNDNAPKFYSSSYSFKIAE
DTEIGERLLQVSAFDLDELYAESTLVYSIVSENKDFFQVDENTGWLSLKKKLDREVTGSH
EILVVATDIDGKFDSTRVQLLLVDVNDSPPIFLSASYFVTVKEDALVGQTILKVKAVDPD
INQNLQYFVLSNNFDDFTVDRQSGNINLLQQMTQVSYNFTVVAYDGIHTGAANIFITVQD
FNNHDPVCLLTFYEADVEENSDLKKIILRVAAEDKDPSDVLKYQIHGDGNGKFYINEKTG
DLKASSYLDFEVETKYRFKVVVIDLAGHTCTSDIFIRVIDMNDNSPIFLQPLYKATLREN
ATYGVVVTQFFTHNINNIFAVHSQGIITVNKPLEIQRSARYTITVVGTDQGTPSCSSNTT
LDIIVISSNDSPPQFDQFGYLFNIIENNSPGVIIGKIKVTSTTNFNMYAIVMEIIDPTFE
NLFSIEDNGDLKVLKVLDYEVQTRYVFSVKASYKSIPLSSMVVVEVLVDDTNDNFPQFNQ
AEYFTQIDENIRSGTFVTQVFAQDNDGSKENSKITYKIFNDLDVPFSIDFQGVIVVDGSI
DREIKDKYEFEVIAVDSGTVQKSSKAKVKISVTDLNDNAPIISEYNTSIILQEGKLPGTE
ILKLSITDPDTKKNGPPFHCSLFGGDHSIFEIQTEDNNCVLRSKESYNSPVIQEPKVFFV
IVSKPYGVTLIGKVSIFDKDENDIHQYRLTGGTMLEYFSIQPMTGVIEGRPKKGIYTLSV
EVTDGRNSDASLFQIIVNERDHEVEIQSIVISIFEMGVQEFMSKMTQFIKILSKITATSL
NSVFLWSIRAVHNSTGSLRKRKDVENTVEVAVAVKLEDTLSYMDIQLLKKYVEDNKADFK
NNDFNILVSNTECTLKSCGENMKCLVKLNPIENLSPFVPSGYMDFRRTENCYCNDGTEGS
ICHSVNPCSRNPCKGGEKCVATKNSYFCECVDSEKCGLSGESITLNGNSYIEYKLSKSFD
ELFHSLSLHFRTEYKEGYLIYAQAPGKDYFIVEVYGGYLQINFDFGSGRGNLQNKKVKVN
DGNWHYISIQRNNNKISMYLDFNKQGLQAKAPGNSANINIDGRPLVLGAGFTDYGNTTFS
GFIGCIKEPKLNKMLLPFNGRTEIVSRVDLHNTENGCKDSGLCSVKHCPKFSDCVNTFSS
YRCVCLTGHHGLSCISNLTCEDRPCKNDGICTYELVNNIVSYVCTCKDGFTGGQCHIELG
ECALDPCKNNGVCLPPSSESGYTCSCINGFSGKHCELNNNPCLSSPCYNGGVCQNIGNDF
KCTCPSGKSGKQCSAGQHCLITNCENGASCYEKNDNAFCQCKEGFFGNRCQHDVNECLKD
VCHSKGVCVNTPGSFYCTDSLAQVHHEKKQFSLILVVFGVCGLLLFIIVVAAVVFCCKRN
HNGYQPTNQDFETRKYALNTYPIESYELNPPNPPPRGISVPPGYYDDQASSMLYDYSVAL
PGTSNEKIPFKNGSSRTSVEYNSEEELHWDYSGGLEAVIKSKMAREANSLGVTAGVPYGS
DFVELPKLPVRPASRRSSIPGYSESENDIPKLPELPQQIRLSRLSLKSSNHSPSYLRRTP
DRAPPIEENRYSLLSDDTDGESYLQDLLENETNFSDITNVTRPYIKPFQRAKSEVSDVSE
DFDTVTSLNSNDEDDDVEEVDPLDPDNTRKLERDIKRLFKDIQKRTEDD
Download sequence
Identical sequences gi|449676476|ref|XP_002167194.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]