SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676551|ref|XP_002164610.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676551|ref|XP_002164610.2|
Domain Number 1 Region: 620-834
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-86
Family Thrombospondin C-terminal domain 0.000000361
Further Details:      
 
Domain Number 2 Region: 498-618
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-33
Family TSP type-3 repeat 0.00000443
Further Details:      
 
Domain Number 3 Region: 43-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000261
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 426-499
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000128
Family TSP type-3 repeat 0.00016
Further Details:      
 
Domain Number 5 Region: 352-440
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000034
Family TSP type-3 repeat 0.00019
Further Details:      
 
Weak hits

Sequence:  gi|449676551|ref|XP_002164610.2|
Domain Number - Region: 319-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0598
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449676551|ref|XP_002164610.2|
Sequence length 846
Comment PREDICTED: thrombospondin-4-B-like [Hydra magnipapillata]
Sequence
MTDICRLYHWCNKRVRNIVFCEIEANLITRDASVNQTKSFHEIDILSSFDVSEDTPGIDS
ISERYGAYQFYMFSKELIATASISKELIFKLIKSKEFFVSINIRHDKRTPSTVLALQTSS
GKSKLVLWVDSFERKVGLKSHSIKNGKNSIVFKHIPVQQGSWHRLLISFKELDTDSPIVQ
LYVDCQYVGKKDFPLNLRYSLMEDSMDTEIRLGQQKHTHGNDPQKFIGAMQDFKFVFNRA
VDWYNNPKKCLSMDIHVNNFKAYQAPDPFVLEKEIAKLTAGIKSIQLYMAEQAKETSFIL
NWMKTCSKCSIEGPESPGNISVCSGNPCIAEADCISHEGFTYECKCKDGTAGNGMHCGKD
SDSDGIPDKKLNCDDMSCRSDNCVNFPNAGQEDADLDGQGDACDIDDDNDEILDEEDNCP
KVSNVNQVDMDGDGIGDKCDNCPFEKNPDQKDANKDGTGDACVKDRDGDGVKDKADNCLV
ISNPDQLDHDGDGVGNECDNCPNVYNPTQVDADSDNVGDECDSNNDIDRDGIQDDQDNCP
YVPNSNQLDIDKDGKGDVCDLDDDNDGIEDTRDNCQMVANPLQKDTDGNGIGDACDGNYD
GDDIQNVKDNCPLNPSIYNTNFTHYQMIKLDPNGTSQVDPEWEILNHGAEIKQWRNSDPG
LAVGVERFGGVDFYGTFYIHDEKDDDFAGFVFAFQDSSNFYALMWKKEEQTYWIETPFKA
NGESGIQLKVVKSKTGPGEHLRNALWSSSSVAEQTNVLWTDPLKQGWKPKTSYRWSLIHR
PDLGLIRIIIKNGMAVVSDSGYIVDHSFKGGRLGALVFSQKEIVFSDLHYDCNDKKPEDY
NSKFKK
Download sequence
Identical sequences gi|449676551|ref|XP_002164610.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]