SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|449676657|ref|XP_002162185.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676657|ref|XP_002162185.2|
Domain Number 1 Region: 168-314
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 117-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 63-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 301-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 23-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000182
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449676657|ref|XP_002162185.2|
Sequence length 405
Comment PREDICTED: fibrillin-1-like [Hydra magnipapillata]
Sequence
MKLLGFHILFLVFSIFKGDQLTSCSHNYCHKNAICGSTGDSYKCFCKNGYHSIGPEEQSK
RICLNINECLLENINHCVSKQYGGTCTDTDGSFYCGCAPGFKGNGKITSKGGTGCSDIDE
CTIGTHKCYRGGVKHSDYCRNNFGSYVCSCPSGLKLSSDKITCLPINECTDTTQRHKCSR
EATCVDLNIGYKCQCTEGFKNGLEVNNERCIDINECAVDNSGSIQAICDFVNGTCWNTRG
SYVCFCKHGYKRNREVQHHSCIDRNECEEYMHNCNITNKHVKCINTIGSFNCVCDDGFVL
DTNKTNCLDIDECSSSADSEDFPCIYNQLIKAQCKNIDGGFHCICPTGYYGDGKKKGTGC
QDSSIHPKEHCGQAQSSLVDCWNNKESCSHKTSTDTCHIMRDNIK
Download sequence
Identical sequences gi|449676657|ref|XP_002162185.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]